SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004675 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004675
Domain Number 1 Region: 701-1061
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.16e-89
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000546
Further Details:      
 
Domain Number 2 Region: 520-697
Classification Level Classification E-value
Superfamily ARM repeat 8.06e-63
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000285
Further Details:      
 
Domain Number 3 Region: 107-298
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.32e-48
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 4 Region: 332-473
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.01e-40
Family PLC-like (P variant) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004675   Gene: ENSXMAG00000004639   Transcript: ENSXMAT00000004680
Sequence length 1069
Comment pep:novel scaffold:Xipmac4.4.2:JH556737.1:1345779:1364289:1 gene:ENSXMAG00000004639 transcript:ENSXMAT00000004680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMPPRPSSGELWGMHLMPPSILVDCLLPNGMILTLECLREATLITVKHDLFKEARKYPLY
HLLQEESSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILNREIGF
AIGMPICEFDLVKDSEVQDFRRNILNVCKEAVDLRDSNGSHSRALYVYPPNVESSAELPR
HIYNKLDKGQIIVVIWVIVSPSNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLTQEQL
KMCVQEYQGKYILKVCGCDEYLLEKYPLSQYKYIRSCIMLGRMPNLMLMSKESLYSQLPM
ENFTMPSYARRISTATPYMNGETATKCLWTINGTLRIRILCATYVNVNIRDIDKIYVRTG
IYHGGEQLCDNVNTQRVPCSNPRWNEWLTYDMYVTEIPRAARLCLSICSVKGRKGAKEEH
CPLAWGNINLFDYTHTLVAGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDH
FSCPVKFPDMSMIEDHANWNISRELGFNYSHPGLSNRLARDKPLTESDNEQLRQVCNRDP
LSEITEQEKDFLWSHRHYCINIPDILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAM
ELLDCNFPDPMIREFAVKCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLARFLLKKALT
NQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDLL
KQEKKDEAQKVQMKFLVEQMKRPDYMDALQSFTSPLNPAHQLGNLRLEECRMMSSAKRPL
WLNWENPDMMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCL
SIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHALHQWLKDKNKGEMYDQAIDLFTR
SCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQD
FLIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDI
AYIRKTLALDKSEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHAMN
Download sequence
Identical sequences M3ZR32
ENSXMAP00000004675 ENSXMAP00000004675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]