SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000004683 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000004683
Domain Number 1 Region: 43-789
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.05e-256
Family Motor proteins 0.00000000034
Further Details:      
 
Domain Number 2 Region: 1955-2071
Classification Level Classification E-value
Superfamily Second domain of FERM 1.06e-23
Family Second domain of FERM 0.003
Further Details:      
 
Domain Number 3 Region: 2072-2162
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-21
Family Third domain of FERM 0.014
Further Details:      
 
Domain Number 4 Region: 1251-1354
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.42e-20
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 5 Region: 1346-1439
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000103
Family Second domain of FERM 0.0069
Further Details:      
 
Domain Number 6 Region: 1855-1962
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000139
Family First domain of FERM 0.08
Further Details:      
 
Domain Number 7 Region: 1567-1636
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000691
Family SH3-domain 0.0027
Further Details:      
 
Domain Number 8 Region: 793-861
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000083
Family Motor proteins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000004683   Gene: ENSXMAG00000004628   Transcript: ENSXMAT00000004688
Sequence length 2177
Comment pep:novel scaffold:Xipmac4.4.2:JH556984.1:177138:226234:-1 gene:ENSXMAG00000004628 transcript:ENSXMAT00000004688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLPVQGDYVWLDLKTGREFEVPIGAVVKLCDSGQIQVLDDEGNEHWISPQNATNIKPMH
PTSIHGVEDMIRLGDLNEAGILRNLLIRYREKLIYTYTGSILVAVNPYQLLPIYTADQIR
LYTNKKIGEMPPHIFAIADNCYFNMQRNNRDQCCIISGESGAGKTESTKLILQFLAAISG
QHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKS
RVCRQAYDERNYHIFYCMLKGMTADEKKKLGLGKATDYTYLTIGKCTVCDGRDDLKEYSN
IQSAMKVLMFTEKENWEISKLLAAILHMGNLRYEARTYDNLDACEVVRCPHLTTAATLLE
VDCKDLMNCLTSRTLITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVEKINAAIYK
PTSSQPKALRRSIGLLDIFGFENFTINRVKIKKIILPKESKNSLFCSSSSFLQLHLENIN
WQHIEFTDNQDALDMIAIKPMNIISLIDEESKFPKGTDATMLNKLNFQHKLNTNYIPPKN
NYETQFGIQHFAGVVYYETRGFLEKNRDTLYGDIIQLVHSSKNKFIKQIFQADVAMGAET
RKRSPTLSSQFKRSLELLMRTLSVCQPFFVRCIKPNEYKKPMLFDRELCVRQLRYSGMME
TIRIRRAGYPIRYTFVEFVDRYRVLMPGVKPAYKQEDLRGTCQRIAEAVLGKDDDWQMGK
TKIFLKDHHDMLLEIERDKAITDKVILIQKVVRGFKDRSNFLRMRKSAVLIQKTWRGYLC
RKSYGAMRAGFSRLQALVRSRKLCASYHVARQRITGFQGRCRGFLVRRAFRHRLWAVITI
QAYTRGMIARRLYKRLKGEYRRRLEAEKMRLAEETKLRNQMSAKRAKAEAERKHQERLAQ
LAKEDAEREKKEKEEARKKKELVEQMEKARLEPVNDSDMVDKMFGFLGTTNSLPGQEGQA
PAGFEDLEHAHHELVEEDLDEALPLPEDDEEEDLSEYKFAKYAATYFQGTTTHTYVRRPL
KQPLLFHEDEGDQLAALAVWITVLRFMGDLPEPKYHTAISDGSEKIPVMTKIYETLGKKT
HKRELQALQGEAETTPSESLKKNSVRHKLVSLTLKKKSKITEEVTKRLNDGEYGLHGNSM
LEDRPTSNLEKLHFIIGNGILRPTLSRDEIYCQICKQLSQNPSKSSHARGWILVSLCVGC
FAPSDKFVKYLRNFIRSGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLP
VTFMDGTTKTLLTDSATTAKELCNALSDKINLKDRFGFSLYIALFDKVSSLGSGNDHVMD
AVSQCEQYAKEQGAQERNAPWRLFFRKEIFTPWHSPTEDQVATNLIYQQIVRGVKFGEYR
CDRDDLAELASQQYYVDYGSEILLDRLLSLIPSYVPDREIGTSKTVEKWAHFIMAAHKKG
IYAQKRFDSQKVKEEVVDFARHKWPLLFSRFYEAFKFSGPSLPKNDLIVAVNWTGVYFVD
EQEQVLLELSFPEIMAVSSSRGGKLQGQSFTLATIKGEEFTFTSNNAEDIRDLVVTFLEG
LRQRSKFVVALQDSSNAAAGEESTFLSFLKGDLIILDQDTGEQVLNSGWAHGINERTNQR
GDFPADSVYVLPSMTRPQPEVVALVTMTPDQRQESVRVSQIILPETDDRQKPYTLEEFSY
DYFRPPPKHTLSRVMVTKNRGKDKMWSCTREPLKLPLLKKVVGHEELAQEACMAFIAMMK
YMGDYPSKRTRSVNELTDQIFEGALKAEPLKDEIYCQIIKQLTDNHVKYSEEKGWELLWL
CTGLFPPSNVLLPHIQRFLQSKKHHPLSGDCMQRLHKALRNGSRKYPPHLVEVEAIQHKT
TQIFHKVYFPDDTDEAFEVESSTKAKDFCQNISTRLLLKSSEGFSLFVKISEKVISVPEG
DFFFDFVRHLTDWIKKSRPAKDGIIPSLTYQVFFMKKLWTSTVPGKDSFADSIFHYYQEL
PKYLRGYHKCSREEVFHLAALIFRVKFDDNKSHFPSIPKMLRELVPQDLIRQMSPDDWRR
SIIAYFNKQPGKSREEAKLMFLKIIYKWPTFGSAFFEVKQTTEPNFPEILLIAINKHGVS
LIDPKTKDILTTHPFTKISNWSSGNTYFHITIGNLVKGSKLLCETSLGYKMDDLLTSYIS
QMLTNMNKQRSGRGHSK
Download sequence
Identical sequences M3ZR40
ENSXMAP00000004683 ENSXMAP00000004683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]