SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005088 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005088
Domain Number 1 Region: 13-218
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-50
Family DBL homology domain (DH-domain) 0.00043
Further Details:      
 
Domain Number 2 Region: 211-338
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000877
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005088   Gene: ENSXMAG00000005072   Transcript: ENSXMAT00000005093
Sequence length 414
Comment pep:novel scaffold:Xipmac4.4.2:JH556876.1:216306:243494:1 gene:ENSXMAG00000005072 transcript:ENSXMAT00000005093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFSPHPPGLSGCSSIQEQRDRWERKRSRAAKELVQTEQHYCQQLELVTTFFVEILKAKG
TLKEDVREGIFSSIKSIFSMNQSLLVHLENGYIGKGLEKFSSHLHHYNTYVDNIYNANKV
LGIQLKKNKAFRRFKKLQEARPQFNNQKLEDMLQMPVQRIRQYKHLLQDLAANTSPDHPE
FEQLSRAVAAVCEVFQRIQGNAQRHENHLQLCRVQKLLQGRKTRVLAPGRWFIREGWLNM
VPPKGSEAKTKMFFLFSDLLLEARRCSPLSLSNGEKFVSQHAYPLQDAAVEKVFGHTRSQ
GGLLSLTFPNAKLLLMSSNHDDLNDWYQCLNSAVRKLQAKHTVVLQRDEQCGRPLLPAVD
HSNPGRKRDLASVEPSERIQKSVAELECSAPKRTKQSVDAEPIAEDSSSSCVIL
Download sequence
Identical sequences M3ZS95
ENSXMAP00000005088 ENSXMAP00000005088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]