SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005110 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005110
Domain Number 1 Region: 2707-2970
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-71
Family Protein kinases, catalytic subunit 0.00000191
Further Details:      
 
Domain Number 2 Region: 1901-2097
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-51
Family DBL homology domain (DH-domain) 0.0000216
Further Details:      
 
Domain Number 3 Region: 1236-1415
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.1e-50
Family DBL homology domain (DH-domain) 0.000000026
Further Details:      
 
Domain Number 4 Region: 1424-1542
Classification Level Classification E-value
Superfamily PH domain-like 3.67e-32
Family Pleckstrin-homology domain (PH domain) 0.00000304
Further Details:      
 
Domain Number 5 Region: 2095-2213
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-30
Family Pleckstrin-homology domain (PH domain) 0.00046
Further Details:      
 
Domain Number 6 Region: 2602-2695
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-19
Family I set domains 0.0094
Further Details:      
 
Domain Number 7 Region: 254-389
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-18
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 8 Region: 1051-1188
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-17
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 9 Region: 475-616
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-17
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 10 Region: 807-954
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-16
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 11 Region: 2468-2530
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000109
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 12 Region: 1603-1668
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000215
Family SH3-domain 0.003
Further Details:      
 
Domain Number 13 Region: 621-728
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000396
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number 14 Region: 13-160
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000051
Family CRAL/TRIO domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000005110
Domain Number - Region: 169-284
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000114
Family Spectrin repeat 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005110   Gene: ENSXMAG00000005081   Transcript: ENSXMAT00000005115
Sequence length 3019
Comment pep:novel scaffold:Xipmac4.4.2:JH556796.1:604177:721151:1 gene:ENSXMAG00000005081 transcript:ENSXMAT00000005115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSLRTEGIKASDVLPVLKEKVAFVSGGRDKRGGPILTFPARSNHDRIKQEDLRRLVTYLS
TVPSEDVCKRGFTVIIDMRGSKWELIKPLLKTLQEYFPAEICVALIIKPDNFWQKQKTNF
GSAKFSFETSMVSVEGLAKLVDPSQLTEDFEGSLDYNHEEWIELRVSLEEFMSNAVHLLS
RLEDLQELLSIKDFPADVEGSRRLIEEHTQLKKKVQKLIYLKVEKLLLTELSEMSQAENR
SKSKEFSKHNILMNLVASLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDW
ISHNKEVFLQSHTEIGRSYQHAVELQTQHNHFAMNSMNAYVNINRIMSVASRLAEASHYA
STQIKQISSQLDQDWKSFAAALDERSTILAMSSVFHQKAEQFLSEVETWCKVCSEGGLPS
EMQELEIAIHRHQSLYEQVTQAYTEVSQDGKALLDVLQRPLSPVNSDSLTATANYSKAVH
CILDVVHEVLHHQRRLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTG
VGKSLHRARALQKRHDDFEDVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVR
IQDFVRRVEHRKLLLDMSVSFHTHTKELWSWMEELQKQLLEDVSCDSVDSVQTLIQQFQQ
QQTATLEATLNVIKEGEELMQQLRDAAMSTSKTPHCSSIAHIQGVLQQLDEAQGQMEELF
HERKIKLDIFLQLRIFEQYTLEVTAELDAWNEDLSRQMSDSGAEDISLAEQRLKRHAERK
TAMNNMAYEVMQQGQDLHQYIMEVQASGIELTGEKDMDLASQVQELLEFLHEKQQEVDIS
TQHTHTRLEQTLQLRHLQAEVKQVLGWIRNGESMLNASMVNASSLSEAEQLQREHEQFQM
AIEKTHQSALQVQQKAEMMLQAGHYDPEAIRSCAEKVAVHWQQLMLKMEDRLKLVNASVA
FYKTSEQVCSVLESLEQEYRRDEDWCGSHEKLGSSVESEHLLPLISKHLEQKEAFLKACT
LARRNAEVFLKYIHRNNVSTPGAAGHARGPEQQVKAILNELLQRENRVLHFWTLKKRRLD
QCQQYLVFERSAKQALDWIQETGDVYLATHTSPGDSSEETQQLLNNYHHFKLSAKQTKEK
VKLLIQLADNLVEKGHAHVLELKRWVSTVDRRYRDFSLRMAKYQESLERSLGITSEVQDN
KDLELDIMPASLTNDPEVKLRDPNHEVDEEKRKSARKKEFIMAELLQTEKAYVRDLQECL
ETYLREMTSGEEEIPPGIANKEQIIFGNMQEIYDFHNNIFLKELVNYEQLPEDVGHCFVT
WADKFHIYVDYCKNKPDSSQLILEHAGSFFDDIQQRRALANTLNSYLIKPVQRITKYQLL
LKELLSCCEEGKGEIKDGLEVMLSVPKRANDAMHLAMLEGFEENLEVQGELILQDSFQVW
DPRALIRKGRDRHLFLFEFSLVFSKEIKDSAGRTKYQYKNRLLTTELGVTEHIEGDPCKF
ALWAGRTPSSDNKTVLKASSMEAKQEWIKNIREVIQERMTHLKGALKEPLHLPKAPALTK
PRNFTKREGGEDGDSQGDGSSQPDTISIASRTSQNTIDSDKLSGGCELTVVLQDFTAGCS
TELSISTGQTVELLERPTERPGWCLVRTTERSPPQEGLVPSSALCVSHSRSSVEMDCFFS
SVSSLTLPSGDSVQPRRITSLQPFFSDHQSSSPNVSKRSGNQKWKWLPSSGRRISSGKKP
SSTKQKKPVSQERRTLKSVQTQSLNQQDEDPSLAVPCLLYQRVSIKDGNPPSKQSPGIQS
GGEEEPEPDDEPHLPLPPPMEIMKDPSASEEKSSSLLTSLQSSSDVPSAAELVSAIEKLV
KTKMDICLKLAPILLSVQQSGFTPPSPPEQHTPVQARNSEQDQKAKAMRHRTFVLNELIQ
TEKDYVKDLGIVVEGFMKRIEEKGVPEDMKGKEKIVFGNIHRIYDWHREFFVGELEKCVD
DNGLLPELFIKHERRLHMYVVYCQNKPKSEYIVAEYDKFFDGIQQDIQSKLSISDFLIKP
IQRITKYQLLLKDYLKYSSKAGIDCKQIEKAVALMSEVPKLCNDMMNLGRLQGYEGNLAN
QGKLLQQETFFVTEQDAGVLSRSKERRVFLFEQIVIFSELLRKGSSTPGYQFKKAIKVTN
LGLEETVDNDACKFVMFSRGSSERFTLQAANVDTKQVWVQHIQNILDAQNDFLSGVDTHT
HTHTHTNTHVPLNVTYEMKLQSTTIYLTQDPEHRTPESLAENGTYNIDNVFKELVVFIKR
MAKQRDNLSLRCVHLSLQSNERPENYYPTLCTWAISILYTNGTKVLKQLNNEEEAFSTAP
RYPVAAQQKQSTLTFSLQSPIVYQQCQSKDSGSSLIRRSSSSGNRPSSSSHSRPSSALGF
SEKSPLKVSTSNGSSSCFESSHALLFRNLSKRNTHSLDCDSPESEAELSQIEVPSRKPHG
VHDDCNGLFSTMRVTQDYSALKENEICVSRGDVVQVLTINQQNMYLVFRPADSQSPEAEG
WLPGHVLGPPTNLVNETNHATVQKSLSWNTLRARKRAESRDSSFLGFRTLGPRRPYKKAP
QMLQNDVSLKLLNPNFIQEVAPEFLVPLSDVVCAFGETVVLCCKVCGRPKPTVTVKGPDQ
NPVTSNNRFTIDIRDTGDILMKICNLMPQDTGIYTCVAVNDHGSASSSASIKVQASGCDG
TGVQWKENFESVFTEISEIGRGRFSVVRKCLNKSTKKEVAVKFVNKKMQKKEQVSHEADI
LRHVQNHHLVALLDTYESPTSLMFILELLEDGRLLEYLVAHDELMEEKVAFFIRETLEAL
QHLHTCRVAHLDLKPENIMVDLKAPAPSVKLIDLGDAVQLSASRRYVHLLLGNPEFAAPE
LIRGMPVSVSTDVWSMGVLAYVMLSGVSPFLDESPEETCVNICRLDFCFPDEYFHHVSQA
ARDFVSSVLQEDPRKRPSATSCLQHPWVGRGGAQGGEYSKMPLDRSRLATFIDRRRQLHD
VRPITNIKGLVSSTMGNTL
Download sequence
Identical sequences M3ZSB7
ENSXMAP00000005110 ENSXMAP00000005110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]