SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005185 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSXMAP00000005185
Domain Number - Region: 433-519
Classification Level Classification E-value
Superfamily PH domain-like 0.0226
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005185   Gene: ENSXMAG00000005164   Transcript: ENSXMAT00000005190
Sequence length 1267
Comment pep:novel scaffold:Xipmac4.4.2:JH556796.1:986171:1010214:1 gene:ENSXMAG00000005164 transcript:ENSXMAT00000005190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQLSDEEVEDEEEEDSDKEDQDLDKMFGAWLGELDKLTQSLDDGRPECPPQQKAPLRQE
TNMANFSYRFSIYNINEALNQGENVDLNALMADLSSIEQELSTINTKSSSSSSSMARLGL
TDTKRASSSSSSTRASPAGTIRSPSGQQGRPPLASNFSLDDITAQLEKASLSMDEAARQT
SSHSLSSASSRQHRRTGSVGTVSEHEVRSFVHSSRSSVTSASGISVNSTSSMDSLDSVLR
SESDDPQPSEGSGQAHPNTEEELAAPQWKDYTAVNSLSALPHTHTRTHTHTKDDTLCSVL
LGIHSIIKALVEEELLNQICTFQSLRSWSSTGPQLQLHNRRGRTGGRRLSWNSESKSSLF
FLQRISEKCSIKNSSLHLLCFENKSQHSYLDRETSLILRNIAAWSSVQVPAVQQTVLLKY
DGRLTWGKCIHLRDTEFIFVLNSDSNSVTVCVLCIQNFKTNKFNRDRQKGSVMDTPSVIT
LLRKHPQIQKKSQYIKYLCCDDIRTLQQWINSIRIAKYGKQLYINFQEAMRRTEAAYDWS
SLSSSSIKSGSSSSSLPESQSNHSSQSDSGVSELTSSGHTRSQSVVSSIFSDAWRRGTQG
EVPAMMKMDPISRPIPVQIPSLSPQSQTPPSRSSYTDGLIPPRTPPLLRPRPPPPPPPPL
AVSSMGHQGAPPSSYVKYSTLARLQSQNQARTQQVAGAGTTPLPLQNYNTLPASYGTSPP
SPPPPPPPVAPAPGSAMAALKFGLPSPNCLPPPPLPEEEALEPHSLPEGLDANGLPPPPP
PEPLPNPCPQLSKFPPLTAPKPSGPSSLPIALSPVSPTQPFSGHCPVRKQQSFSTGHSPN
QPPPTLPKQHSLSSKNLAISPSASSSSVSIAAATSSLVKQIVNQFPGNTSPIPPSSSAPQ
SPPAVKAKPKWQIGGAAVPQSPEFPPPPPDSSLGDFPPPPSSSSKSGSPIKKSPSTSSTG
SAKRGPPPTPQRASSMKDPQDERPKKVESLLSKFATGSPSKDSASLPAPLPKPGKLNLAN
LPLVIQGLQSGQQHQSDFPSPPPPPPASQHPHLDSSADFFPPPPTESELFPPPPHPSEFH
HPPKVAVVNPQPQSSWKQGSLKKGAMPPPAMNRRSSNTAQFENTISLPLSPPPLSQTPPP
SPPTSPKSAGPASLAFKPHFLEDLNRTLKRKSVSRHGSLTSSHLIPSSKMEPVGTMDDMA
LLPPPPPELLPQQHQQGVRGHSHTLSRHHGRSQSAKHGNISGYATLRRGPPPAPPKRDQS
TKLTSEW
Download sequence
Identical sequences M3ZSJ2
ENSXMAP00000005185 ENSXMAP00000005185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]