SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005205 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005205
Domain Number 1 Region: 181-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.46e-55
Family DBL homology domain (DH-domain) 0.0000858
Further Details:      
 
Domain Number 2 Region: 406-525
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005205   Gene: ENSXMAG00000005187   Transcript: ENSXMAT00000005210
Sequence length 633
Comment pep:novel scaffold:Xipmac4.4.2:JH556876.1:495186:525334:-1 gene:ENSXMAG00000005187 transcript:ENSXMAT00000005210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIKINENSEVESAMSPSEKENGKEQAADIKVKFSAGEAESDNKTLRRSLRRGGSFTFLT
TGSQWDFTLKRKRRQKDDADTISICSSDFKKWKDRQKDDSDSISICSFDFKEPSTKRVRP
HGRVTSLASLISPVKNGAVRRFGQTLQASFRGDGKSSAGPHKPCSKATAPTPPKRRNSTL
WSETLDVRQKGTFSTQEIKRQEAIFELSRGEHDLIEDLQLARKAYHDPMLKLSIMSEEEL
THIFGNLDDYIPLHEDLLARLSKATGSDGTVGQIGQIVISWLPRLNAYKEYCSNQLAAKA
LLDQKKQDRRVQDFLQRCLESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPPDHPD
AGLLEEAITIIQGVLSDINMKKGESECQYYIEKLEYLDDRQRDPRIEQCKSLLCHGELRN
KSGTKLHVFLFTEILVLTRPVTRNERQCFQVYRQPIPVQDLVLEDLQDGDVRMGGSFRGA
FSNSEKAKNIFRVRSQDPSHSQSHTLQVNDVFHKQQWLNCLRSAISVHRPTGEPSTASPH
MSNVHSKRRMSSASAIIHLEEPDENCPRQTSQSAPSSPCGSSTSGSTTSSLSSHSSSSLA
SPLSAPLFSSSSLKCKKDKRSLGSLGKRKETMV
Download sequence
Identical sequences M3ZSL2
ENSXMAP00000005205 ENSXMAP00000005205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]