SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005207 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005207
Domain Number 1 Region: 129-267
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000393
Family Second domain of FERM 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005207   Gene: ENSXMAG00000005188   Transcript: ENSXMAT00000005212
Sequence length 467
Comment pep:novel scaffold:Xipmac4.4.2:JH556714.1:546846:557600:-1 gene:ENSXMAG00000005188 transcript:ENSXMAT00000005212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGDNCSFPPDLSDDHSQRGSVASSATLSRAQDVLVYLFGESAVHLSVEGLGSVSVQELG
RSVREALQIPESAPDAFAFWLCSPLLELQLKVRHQPYKLCRQWQDLLYRFTDASEDDISQ
DEPYLQYRRNVFYPKSKELQIKDEAVLRLLYEEARSNILSGRYPCDPEHWAGLGALSLAL
EEGPGLDSQQITTKIREKKLPSFVPAHVAMGSGGFFSTLRGKSSRQAELEQKLSEEYGKI
SKSTGSSLEPQQLLHQYLSMCHTLPYYGCAFFCGEIDKPAQGILQRGKRKAVSVGICLDG
VYVMDVKEKHVLLGLRFSELSWDHSRPEEEGDSHILWLEFDGEEDGTPVNKLLKIYSKQA
ELMSGFIEFCVELMSTSEGGAANEPGVPQEPTGQEAGTRNGRGGRRGMLQRQGSVVCSRV
HSLNTISYVDNGKEIKRLKPKRAASFFARQATAPTYSAVNTESLEQG
Download sequence
Identical sequences M3ZSL4
ENSXMAP00000005207 ENSXMAP00000005207 XP_005800862.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]