SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Xiphophorus maculatus 69_4.4.2 > ENSXMAP00000005282

Domain assignment for ENSXMAP00000005282 from Xiphophorus maculatus 69_4.4.2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSXMAP00000005282
Domain Number 1	Region: 27-119
Classification Level	Classification	E-value
Superfamily	Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain	2.49e-28
Family	Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain	0.0026
Further Details:

Domain Number 2	Region: 106-204
Classification Level	Classification	E-value
Superfamily	Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain	2.62e-16
Family	Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain	0.0037
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSXMAP00000005282 Gene: ENSXMAG00000005275 Transcript: ENSXMAT00000005288
Sequence length	215
Comment	pep:novel scaffold:Xipmac4.4.2:JH557017.1:47432:50791:-1 gene:ENSXMAG00000005275 transcript:ENSXMAT00000005288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MSDESSEDFEDDRNKLGEYEGGRNDIGERHGLGKALLPNGDIYQGSYENGKRHGNGTYRF RNRARYVGDYVQNKKHGQGTFYYPDGSKYEGAWVEDQREGLGVYTYPNGDIYDGEWLQHL RHGQGTYLYKDTGAKYKGTWENGNMNSAGEYIYANHRYEGNFVKNTPQGPGKYVFDIGCE QYGEYLKPDQDLAEETISTDGGPKWSPEYITSLTS
Download sequence
Identical sequences	M3ZST9 ENSXMAP00000005282 ENSXMAP00000005282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]