SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005307 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005307
Domain Number 1 Region: 163-303
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.36e-26
Family UBX domain 0.0099
Further Details:      
 
Domain Number 2 Region: 6-56
Classification Level Classification E-value
Superfamily UBA-like 2.74e-16
Family UBA domain 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005307   Gene: ENSXMAG00000005289   Transcript: ENSXMAT00000005313
Sequence length 309
Comment pep:novel scaffold:Xipmac4.4.2:JH557664.1:27595:31851:-1 gene:ENSXMAG00000005289 transcript:ENSXMAT00000005313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTTLESLLEMGFGRNRAEKAVANTGNQGIEQAMDWLMEHENDPDIDEPYVPPAGNLL
GGDTDQTTAGDSGEAAVIAEEDELYSDNPEASRRPMTEEEKREQVKRLEELMRVKQAERR
ERERAEEVEREKQRRRQGQELQQIRQKIQDDEMKKLADQRRREKMEDKMARQRVKDKIAR
DREERAQKFGGGAPPSTVTSTQPTPPSPSSPTGQGPPPTKKEYDESRIQVRLLDGSTINA
VFKAQEPLAAVRVYVQMNGNTPEGQDFTLLSPYPRHVYTELDMEKPLKELGLVPSAVLVV
TKKSEGSAL
Download sequence
Identical sequences M3ZSW4
ENSXMAP00000005307 XP_005814923.1.87360 ENSXMAP00000005307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]