SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005353 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005353
Domain Number 1 Region: 7-165
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-36
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 
Domain Number 2 Region: 180-248,306-340
Classification Level Classification E-value
Superfamily PH domain-like 2.69e-20
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005353   Gene: ENSXMAG00000005347   Transcript: ENSXMAT00000005359
Sequence length 375
Comment pep:novel scaffold:Xipmac4.4.2:JH556714.1:939599:961489:1 gene:ENSXMAG00000005347 transcript:ENSXMAT00000005359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAAATSSQPVLTMQQIETIFYKIQDIFEIHKEFYDALLPSIQRWDEKVTVGHLFQKLASQ
LGIYKAFVDNYKNALETAEKCSQANNYFQKISETVSVKGPKDSKDSSTKSSMENLLYKPI
DRVTRSTLVLHDLLKHTPKDHPDFPLLQDALRISQNFLSSINEEIDPRRTAVTTPKGEAR
QLVKDGFLVEVSESSRKLRHVFLFTDLLLCAKMKKTAVGRHQQYECKWYIPLADLTFQTL
DDSDSCPSIQVLPEHEIEEMKMKISVLKNDIQKEKKAPKGQSRAERLRKKMNEQESWLLL
QSPTIPFRIHNKHGKSYLFLLSSDYERAEWKESIQKLQKKDLQACMLSSVELQVLTSSCF
KLRTVHNIPVTTNKD
Download sequence
Identical sequences M3ZT10
ENSXMAP00000005353 ENSXMAP00000005353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]