SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005402 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005402
Domain Number 1 Region: 19-213
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.85e-47
Family DBL homology domain (DH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 255-441
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.94e-25
Family BAR domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000005402
Domain Number - Region: 505-555
Classification Level Classification E-value
Superfamily SH3-domain 0.000266
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005402   Gene: ENSXMAG00000005387   Transcript: ENSXMAT00000005408
Sequence length 557
Comment pep:novel scaffold:Xipmac4.4.2:JH556843.1:21:11395:-1 gene:ENSXMAG00000005387 transcript:ENSXMAT00000005408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLDLSALPSPVLDVEEIWSRKMSRRAKVIKELVQTEKDYLTDLELCIREVVQPLRVLQV
VDVDRLFTNMETVCEVSAALLNRLHVAMSDPDPEAVVIGEVFIQAKAALEDVYKIYCYHH
DDANMSLKAYEKEEQIKQHFTICILALKGKPNLLDMGSLLIKPVQRIMKYPLLLGELWQA
TPEDHIDYLPLQEALTAAKIINVNINEFRRRKDIVMKYKRLENDEGTLRGKLNKINIHSL
RKKGDRFAGYLKILTGVEPQVRDEVFDKEEKLFRSLEKAVRQLAKNVNCYVQYTQVRRLY
YLFQPKPLSSCIQTAPSEFSNLCKSTILPSLLFQKERMEELVLLPLTSLQGMFTAPQKLI
QKRYDKLLDYCCRLERSSSFASSSSTTVSSTASPASDAPPGPAKRDYEAINALLVDELQR
FNMAAYTILTNCVLCLVALLRGLMVCALVGAPAVHQLPVRITHTHTPAPPLSNMVEDNAQ
KLMERKVSFERQRDKKTVVQEVQHQTEEQRAWLLAEYPPNRLYQLKRKCNGCQEQDLSLL
EGELVALLEDTDPLGSS
Download sequence
Identical sequences M3ZT59
ENSXMAP00000005402 ENSXMAP00000005402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]