SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005556 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005556
Domain Number 1 Region: 63-280
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-60
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 264-398
Classification Level Classification E-value
Superfamily PH domain-like 6.68e-31
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 
Domain Number 3 Region: 443-601
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-22
Family Pleckstrin-homology domain (PH domain) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005556   Gene: ENSXMAG00000005540   Transcript: ENSXMAT00000005562
Sequence length 627
Comment pep:novel scaffold:Xipmac4.4.2:JH556666.1:651944:708182:-1 gene:ENSXMAG00000005540 transcript:ENSXMAT00000005562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQDKETEEETHHSVRTETAELVNGDLERPDEVDDHSASQHSDRTGAENEDREKTTETQQ
KSEEGHSEQKETNEQKLFKIASELLHTEKAYVARLNLLDQVFCTKMMEEANKGTFPLDVV
KNIFSNIASIHAFHSQFLLPDLEKRMGEWASTPRIGDILQKLTPFLKMYAEYVKNFDKAM
ELLRQWTDRSPPFKAIIQEIQSQEICGSLTLQHHMLEPVQRVPRYEMLLKDYLKKLPQND
PDRSDAEKSLEIIATAATHSNSAIRKSENLKKLMEIYEMLGEEEDIVHPSNEFIKEGHIM
KLAARNTSTMDRYLFLFNNMLLYCVPKFSLGGPKYTVRTRIGIDGMKVVETSNEDHPHTF
QVSGKERMLELQAGSEQDKAGWIKAFRETIDIFQQKNESFKNALKDVEEVSKAELGKRAP
RWIRDNEVTMCMKCREPFNAITRRRHHCRACGYVVCWKCSDNKAHLEYDNYKVNKVCKDC
YSILTGEGVTGGRRKGILEIEAAQFTDSSIMSGFLQHSEKGGKLWQRVWCVIPEKECLVL
YLYGAPQDVKALCTIPLLGYTVEDADTPASFRLSQSKFVHTFAAESEELKQRWLKVIRAA
VTGEMPARPETNGGENSGTQEANPDDT
Download sequence
Identical sequences M3ZTL3
ENSXMAP00000005556 ENSXMAP00000005556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]