SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005626 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005626
Domain Number 1 Region: 942-1052
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-24
Family PDZ domain 0.0000414
Further Details:      
 
Domain Number 2 Region: 5-105
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.11e-24
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 357-456
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.52e-21
Family FHA domain 0.0000164
Further Details:      
 
Domain Number 4 Region: 211-311
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.84e-20
Family Ras-binding domain, RBD 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005626   Gene: ENSXMAG00000005607   Transcript: ENSXMAT00000005632
Sequence length 1173
Comment pep:novel scaffold:Xipmac4.4.2:JH556824.1:1083292:1134403:-1 gene:ENSXMAG00000005607 transcript:ENSXMAT00000005632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDLEFHGVMRFYFQDRVAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLY
EVHVSGEERQLDLDEKPLVVQLNWNKDDREGRFVLKNENDVLPKKSQSNGPEKEKDGVIQ
NFKRTLSKKEKKEKKKREKEFARIPDGDEQILSREDGENNRLAAEVYKDMPETSFTRTIS
NPEVVMKRRRQQKLEKRMQEFMSSDGRPESGGTLKIYADSLKPNIPYKTILMSTRDTADF
AVVEALEKYGLEKENPREYCIARVKTQPLHQEEKTGKEVILDDLDCPLQILRDWPADRAS
GAMVFQLKKRPPDYQPRKGRKDDKGLRGKDGSMPPEKLPYLVELSPGRGNHYAYYAYRHQ
EDGSDSRDKPKLYRLQHSITEVGSDCTEDGAIQLLGPGILPHHCNLMHSEGMVTVTPHGH
DADTFVDGQRITETTVLRSGSTLQFGSAHVFKFVDPMVDQGGKRDPNAAMRSRHKSGSVP
ETTFDLRGDVLSGAPLPTSKEGEKLRFNKASSGKLEMERGMVKPMIRGEQQDSRVLSVHL
NRSQDLSADRTELTLPASIDFRENSEDTFLSAIINYTNSSTVHFKLSPTYVLYMACRYVL
SPTYRPDMSPSERTHKVIAIVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFVKQDR
DLSRVTLDAQDILAHLVQMAFKYLVHCLQADLNNYMPAFLDDPEEHNPQRPKIEDVLQTL
TGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNKLVTDADSGLCCHYWGAILRQQLSHI
ESWAEKQGLELAADCHLSRIVQATTLLTMDKYSTQDVQNIHNTCFKLNSLQLHALMTNYR
CAQDEPYIPPDLIDHVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVR
HLPNGLQDFLEPLLHFPGFCRLTPHPRSPGTWTVHFEGADNDNHFSAADNTEMLQPMRKE
PEVVTVTLKKTNGMGLSIVAAKGAGQEKLGIYIKSVVKGGAADKDGRLAAGDQLLSVDGR
SLVGLSQERAAELMTRTGSVVTLEVAKQGAIYHGLATLLNQPSPMMQRASDRGRDKNGKM
RPKSEGFELYNNAVQNGDPESPQPGWDSYAEPKKMSGEDRLLKNRADHRSSPNVANQGQS
PATKSVYPGGPGTKITSVSTGNLCADVSAETPR
Download sequence
Identical sequences M3ZTT3
ENSXMAP00000005626 ENSXMAP00000005626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]