SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005661 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005661
Domain Number 1 Region: 10-118
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 7.85e-28
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005661   Gene: ENSXMAG00000005648   Transcript: ENSXMAT00000005667
Sequence length 145
Comment pep:novel scaffold:Xipmac4.4.2:JH556678.1:129484:147959:1 gene:ENSXMAG00000005648 transcript:ENSXMAT00000005667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLTRGSFTYSNGEEYHGEWKEGLRHGLGQLIFSDGTCFTGQFENGLFNGCGVLVFPDGS
RYEGEFVQGKFQGAGVFTRFDGMKFEGEFKGGCVDGHGLLTFADGGRGVSHEGLFETNQL
KRRESSHAAVQRAQAASAKARALAS
Download sequence
Identical sequences M3ZTW8
ENSXMAP00000005661 ENSXMAP00000005661 XP_005797518.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]