SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000005765 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000005765
Domain Number 1 Region: 508-608,4427-4523
Classification Level Classification E-value
Superfamily Fibronectin type III 7.7e-39
Family Fibronectin type III 0.00071
Further Details:      
 
Domain Number 2 Region: 5796-5914
Classification Level Classification E-value
Superfamily PH domain-like 2.39e-33
Family Pleckstrin-homology domain (PH domain) 0.00083
Further Details:      
 
Domain Number 3 Region: 5594-5785
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-28
Family DBL homology domain (DH-domain) 0.00046
Further Details:      
 
Domain Number 4 Region: 10-99
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-24
Family I set domains 0.0061
Further Details:      
 
Domain Number 5 Region: 5034-5126
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-23
Family I set domains 0.0075
Further Details:      
 
Domain Number 6 Region: 5921-6018
Classification Level Classification E-value
Superfamily Immunoglobulin 1.32e-22
Family I set domains 0.0045
Further Details:      
 
Domain Number 7 Region: 108-199
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 8 Region: 6009-6106
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-21
Family I set domains 0.0077
Further Details:      
 
Domain Number 9 Region: 240-329
Classification Level Classification E-value
Superfamily Immunoglobulin 6.31e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 10 Region: 3711-3804
Classification Level Classification E-value
Superfamily Immunoglobulin 6.81e-21
Family I set domains 0.009
Further Details:      
 
Domain Number 11 Region: 4812-4906
Classification Level Classification E-value
Superfamily Immunoglobulin 4.46e-20
Family I set domains 0.0048
Further Details:      
 
Domain Number 12 Region: 5282-5384
Classification Level Classification E-value
Superfamily Immunoglobulin 3.96e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 13 Region: 3898-3989
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-18
Family I set domains 0.072
Further Details:      
 
Domain Number 14 Region: 2099-2184
Classification Level Classification E-value
Superfamily Immunoglobulin 5.33e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 15 Region: 5171-5266
Classification Level Classification E-value
Superfamily Immunoglobulin 5.62e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 16 Region: 3102-3194
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 17 Region: 3532-3625
Classification Level Classification E-value
Superfamily Immunoglobulin 1.88e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 18 Region: 2764-2847
Classification Level Classification E-value
Superfamily Immunoglobulin 3.81e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 19 Region: 3191-3283
Classification Level Classification E-value
Superfamily Immunoglobulin 4.77e-17
Family I set domains 0.02
Further Details:      
 
Domain Number 20 Region: 3443-3536
Classification Level Classification E-value
Superfamily Immunoglobulin 6e-17
Family I set domains 0.061
Further Details:      
 
Domain Number 21 Region: 3631-3720
Classification Level Classification E-value
Superfamily Immunoglobulin 6.81e-17
Family I set domains 0.02
Further Details:      
 
Domain Number 22 Region: 3020-3106
Classification Level Classification E-value
Superfamily Immunoglobulin 3.79e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 23 Region: 2218-2303
Classification Level Classification E-value
Superfamily Immunoglobulin 5.12e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 24 Region: 1138-1219
Classification Level Classification E-value
Superfamily Immunoglobulin 5.17e-16
Family I set domains 0.029
Further Details:      
 
Domain Number 25 Region: 1739-1823
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000105
Family I set domains 0.0077
Further Details:      
 
Domain Number 26 Region: 893-973
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000168
Family I set domains 0.052
Further Details:      
 
Domain Number 27 Region: 1048-1129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000168
Family I set domains 0.023
Further Details:      
 
Domain Number 28 Region: 1234-1312
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000281
Family I set domains 0.047
Further Details:      
 
Domain Number 29 Region: 2572-2666
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000393
Family I set domains 0.036
Further Details:      
 
Domain Number 30 Region: 2404-2489
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000103
Family I set domains 0.025
Further Details:      
 
Domain Number 31 Region: 1327-1407
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000155
Family I set domains 0.06
Further Details:      
 
Domain Number 32 Region: 1567-1645
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000245
Family I set domains 0.03
Further Details:      
 
Domain Number 33 Region: 3368-3451
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000283
Family I set domains 0.047
Further Details:      
 
Domain Number 34 Region: 689-783
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000317
Family I set domains 0.013
Further Details:      
 
Domain Number 35 Region: 321-414
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000541
Family I set domains 0.022
Further Details:      
 
Domain Number 36 Region: 4168-4254
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000648
Family I set domains 0.047
Further Details:      
 
Domain Number 37 Region: 2850-2935
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000999
Family I set domains 0.026
Further Details:      
 
Domain Number 38 Region: 1911-2003
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000108
Family I set domains 0.012
Further Details:      
 
Domain Number 39 Region: 2671-2757
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000123
Family I set domains 0.025
Further Details:      
 
Domain Number 40 Region: 1828-1913
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000152
Family I set domains 0.0085
Further Details:      
 
Domain Number 41 Region: 4076-4163
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000304
Family I set domains 0.026
Further Details:      
 
Domain Number 42 Region: 804-879
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000549
Family I set domains 0.015
Further Details:      
 
Domain Number 43 Region: 1654-1737
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000381
Family I set domains 0.02
Further Details:      
 
Domain Number 44 Region: 2002-2094
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000319
Family I set domains 0.0032
Further Details:      
 
Domain Number 45 Region: 426-502
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000464
Family I set domains 0.017
Further Details:      
 
Domain Number 46 Region: 4246-4342
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000543
Family I set domains 0.01
Further Details:      
 
Domain Number 47 Region: 2493-2579
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000653
Family I set domains 0.012
Further Details:      
 
Domain Number 48 Region: 3978-4065
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000483
Family I set domains 0.036
Further Details:      
 
Domain Number 49 Region: 3807-3896
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000062
Family I set domains 0.0081
Further Details:      
 
Domain Number 50 Region: 5510-5573
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000567
Family SH3-domain 0.0039
Further Details:      
 
Domain Number 51 Region: 4345-4430
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000707
Family I set domains 0.0069
Further Details:      
 
Domain Number 52 Region: 2312-2399
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000806
Family I set domains 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000005765
Domain Number - Region: 613-698
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000554
Family I set domains 0.03
Further Details:      
 
Domain Number - Region: 2178-2220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0383
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000005765   Gene: ENSXMAG00000005741   Transcript: ENSXMAT00000005771
Sequence length 6116
Comment pep:novel scaffold:Xipmac4.4.2:JH556923.1:19466:73468:1 gene:ENSXMAG00000005741 transcript:ENSXMAT00000005771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQNLFGGAPRFLTRPKAFTVGVGKDATLSCTVVGKPTPVITWEKDKLKLSSGGRFKTVE
DGDIYRLTIYDLTLEDSGQYMCRAKNNIGEAYAAVTLKVALQMEMSQRAPVFMVKPTSTR
VALGGDVVFHCRVVAHPEATFEWEKDGRYLGETNRIKIMSDSESSTLKIQGVRNLDSGTY
ICRAQNSVGRSQAAAALVVDTQDARYMSADKSTSLLSHMQKRKEELRASALASLPKGVFT
RTCTVTEGKHAKLSCFVTGHPKPHIIWRKDGTNISEGRRHVIYEDQAENFILKILYCKQS
DNGLYTCNATNMAGQTYSAVLVTVKEPKVPFKRKLQDVEVQEKTSATLMCEAPLIATQTD
WFMEETRLEQNTKYRLDEDGTLRRLTIHNVTTNDDGVYICEMKEGSRTVAELTVLGNITK
KLPRRTIVPVSDTVIFCVELEHPCPDAYWTRNGEKLKEDSRTSIACVLRQYTLTIKDCQA
NDSGEVAFVAGDCKTSTRFSVTAPRKHPPDPPVDAVVQNKTDSSITIHWSPPDSDRPVPI
KGYIVERRKVGASTWQRCNAGEILTATEITISSFSEEASYQFRISATNDFGQSPFLEVPG
SFYLEPTAEIRKGLMNSSAVSGEEFSISVELSAVCSGFWSLNGRLLRSGSEYLITKSKNI
HTLLIRVVTMEMNGTEIKFVGGGSQSSCILSVKAPPIRFTNKSDHPEVVTCSVQETAQLS
AEVSDYETQVAWMKNGREVKMGKKYESIIRDRKRILMVHNVTEEDVGLYECVLSEDRMSI
QLTLKDEPAKFLNKARGPMGLSSSLKGDLELTCEVSSASAVVVWKKDKVEISEDQRTTII
SKGTQRKLIIKSAKKNDEGYYSCETAADKVTFHVKIKEPQAVAAFSNKESIQRDVKAVLS
QKSTLSCDVSDTKMEVKWYKDGKLLESSKRICLEAKESTRQLVIENIEKTDAGEYTCEAG
GDKLVFKITVSGRKAELVTLKCGYHDVLTCKTRCLLISNPFLPSFQLKFHVMMLMLKKMN
RSVLTQFLLALLSEALSAFCNKELVQREVKATLSQKTTLSCEVADRKTEVKWYKDGKLLT
SSKTVQTESKGKSRQLVIDSVEKKDAGEYTCETGSEKMSFKINVAEAQSAFFNKESVQKD
VKATVSQKATLSCEVSDTKTEVKWYKDGKLLTSSKTVHTESKGRSRQVVIESLEKKDAGE
YICEAGAEKLSFKLQVEDVQAQSAFYKKDSVQNEVKATLSQKATLSCEVADSKTEVKWHK
DGKLLTSSKTIHTESKGKIRQLVIESVERKDAGEYICEAGSEKLAFKLHVEETQLKSVFF
NKESVQKEVKATLSQKASLSCEVADAKTEVKWYKDGKLLKSSKTIHTESKGKSRQLMIDS
VERKDAGEYICEAGTEKLAFKIHVAGRRKENNTSFCCRHIPLYWIYFTSLLLFKIKDREE
HKVSNFQNGLSQHKQQIPQCKSCVVTALFLSSHSESMLYCFKEKKNGIKIKSSISNYFAK
SCLQKVSKSELICGLTNMSTHNDVNCKRCFQLKNATYVKAFSDELKYFICSSETTTGFSS
KESVQREVKAALSQKATLSCEVLDSKMEVKWLKDGKVLTSSKGIHMESKGKTRELVIDRM
EKKDAGEYTCEAGGDKLVFKLQLTGTNIAVKFKKPTKDTFIVEASEKVVLTAEMTTEGGN
VKWFRDGVEIKESSKCEIQKDELSRTLTLKSTETKDSGTYSCQTPDDKVEFKVQVKDSAL
KFVVPLKAATVELGGTLSLICELNQASGDVLWQHQGREIKPGNRHCVRTDGAKRILTVTA
VTKEDEGEYSCVCKNDKTSAKVTSKAPRPVRLTTKLNNVAAMEGKDAIFKCAVTPADANV
RWFHNNMPITAGPKYKPEHGGGSFALTITSVTQKDAGEVSVDAEGKSYKATLQVQREPVS
FKKKLENMTVEEENEVKLEVVLSKPSDEVKWMKNSVVVQPAGNIEIRVEGAKQALIFKRV
TYSDRGIYSCETLDDKTQAKLTVEMKKIQVIKALTETKAHETETVTLEVELSQADVEGSW
SRDGAKLKSGTNCRITTVGKKHILTLSNLKREDSGTISFQAEGVHTSSKLIVTEPLAMIS
KPIMDINVPEKEKATFECEVSRNNAEVKWFKDDVELKSTKNIAIHSLGRKRTLVINKCTP
EDGGTYICHTADDNTSAKLTVQGRTYILLFKSVTPEDMGEITFTAEKASSAAKLKVKELP
VKFVKKLRDKIAMYKHRAHLECQVSRASAKVKWFKNKMEIKASKKYEIKGEDVYRKLTIN
DVDSGDEDMYTCDATDDKTSCKVLVEEQSISIVRELSSVEVTEPFAAVFEVEVSMELVKP
PIWTLNGVPVQEGVDVEMEKEGTMHRLTFKKTKASMTGPVQFTAGKSKSLAQLTVKGLER
PLEITEHIKDIKANEKSSAALACTFSATPKEVKWFKGQVLLAASDKYNIRQDAARAQLTV
QKLTEEDSGEYRCQSGPAETKGTLTVEVREIKITKHLADTEVDEDSDAMFTCEINYTDED
AQWLLNEKVLFTNEVNTITHEGKVHKLRLKNLAPQDGGTITFQVRKVKESVTLKVKEKRA
VFLKSLDDVTGEEKGMITLTCEANKPRVSPIWRKEDKVLKAGPKYELLHTGKSLGLIVKD
VTKEDAGEYSCDLGTEVTKAKVTVREIGIGITKKLKSVVVNEGDTCSFECILSRESIDDC
LWSANGKAIKNGGRFKISSQGRKYTLTLKDVTPADAGEVVFSIKDLSSKATLKVEGKASS
LSNGLQNVSVVCGEDAVFACEVTQASFTVKWAKDGKAIRTSKKYEISQQEKLMKLTIHTV
SAEDSGEYSCEVVGGATTRAKLEIKEPIHKFTKVLEDIQADEQTSVTLRCETEQTPSAVT
WLKGHTELRAEGQYEMSQKEKVLTLIIKHLEEKDTDIYTCDVGTAKSMAKVTVKGEKLGL
YKELKTSLSIPPQPDLTQKLNVIPSDEEEGDSPCFCGDQTTFANLKMGYEIISSLSEVVK
KHQSCVKFCCYIKPTCAALPSTFVKKLESQEAEEGASVTLHCELSRPGVSVEWKKGTQIL
KSGEKYQMKQKASVNELIINKLVPEDSGDYSCLSGDQKTTANLKIKAQKVIFKQKLENQE
AEEGASVTLHCELSKPGVSVQWKKGTQVLKSGEKYQMKQNASVNELIISKVVPEDSADYS
CVCGDQKTTANLKIKAQPVTFKQKLESREAEEGASVTLRCELSKPGVSVEWKKGSQALKS
GEKYQIKQKASVNELIINKLVPEDSGDYSCLCGDQKTTANLKIKALQANMFYNLRHRNNI
ECVVLTLSGLNWYCHSHVDPEEMNPGRLSLLDGQRHLIKKTGLLAYVLCFQNIKLNTLFV
QVVCNKDLESCVSEEGASITLHCELSKPGVPVQWKKGPEVLSHGEKYQLKQTGLRYELQI
FDLTPQDTGTYSCCSEDILSSASLVVNASPVFFKRELECQTVEEGQSATLQCELSKLGVS
LEWRKGELGLCPCGKYEIRQTENLATLIIHDVELEDSGSYTCDTGEHQSTANLSVKAKPV
LFKTKLQNLERQEGESVSFCCEITKLGASVVWRCGDKVLTASSKYQLKQEGTVVQLVIYK
LQLSDAGEYSCDTGFQKTSATLNVNAAEVLILKFLESCVVHEGEDVHFECQLSHEETPQI
QWKLQDVPLQNNEMNLIRSEGRVHSLTLRGVTASDSGTVTFTVGNHTSTASLTVRVPPIS
FKKELESQEAREGGETTLSCETSSPDCKVTWWKGSTVLSQGEKYTIQQRATTHSLVIRKL
VKEDSGEYTCDTGDKKCTARLTVKEHVRIVRELHDVTVTTGQDAIFEVELSHVGITHGEW
WLGDNLLQNNDLNQMSVQGRVHRLALKMVTTDESGDVAFVVGEEKSVACLLVEEKPKVVI
LEKPHNAAAAEGETVTLSCSISDSNASLTWMRNNVPIQAGIKYDLKKNGAVHQLRIHNLV
PEDSGIYICDTGDAQCEVTLTVQGAPVFFKKELKSQDAIEGDDITLQCEVSKPGVRVEWR
KGGIVLQPSLAVQGSLHAVPSTSVLIVYCLSAELFGFNLVYACVCIFHSTVKEVFIVTGL
KTTDVFVGEWATFSCQLSGRAPGKVQWWLDGTLLENNPCIDIGVEQGFIHTLTFKNLATD
DSGTVTFKTGNLTSSAKLLVKDPMVEVVNDMEDLWVVENQPAEFICQFSRPVKAQWRKDG
QLLQPDGRRVVVEQDWTVARLYINRVSGADTGTYSCEAEGTSVVASLHVEAKPINIVQGL
ENVETFDGGEALFECALSRPESKDCHWLLDGKPVKESRKAEIVSFENGRRHLLLLKDLHD
KDSCTVTFKAGTTSTSAQLTVKGWKLEIVQGLEDKVAAVGEKVEFCVKLTEAVPAADVTW
YANGVELKPSDLWAMRVDGSSYCLVLRQAPLMPQQEITFAARDALSLAKLTIITVPDPPE
DPEVLRKTTESVTLSWFTPLHDGGSPIIGYRVEMRLVDSALWLPCHSEPACNTEFVVEKL
VPGSGYRFRVAAINKAGPGEPVELPLTVQLGEWTNTFGMWSETPVSQRLISFQYIYIYIE
NTEMFLVILWPTKSWASMHMNGKLSESPNPKAEFCVFIGCIRHNYLNYQHMVVLCSVYSN
LNHIMVISSDVKQTKVMEQPSLPPESAEEGELHDLWDASAKKRRMSREPTLDSISEQPED
NSKAGKKQQKESVSSEKVEITAAEKEQVDVSKRQTESVQSISSEDETVSGGASLVSYLKK
SSKTETTATKQKTVQQTESKTKIIQKVEEKQLSTQETSIMEITKEEEPELTDAAIKIQAA
FKGYKARKDMRPIFKEVFKDQTKEPNDTIHLECVSEGKPEKVRWLKDGEPLIDGKHHHID
IYNDGTCALVITAITTKDTGVYTCEVTNKFGVTSHSAKVTVGTADSEPESSSGSEMDESL
RQASRRLRRLLRTRLPPDVEEEPFISADEGDLRPPDPHSYREDENYIYICFDSQSEAEIA
SKRFQEMFTVHGVPVETAIIAAGTHKVELRIRKDGTQTPTQDRQPPALLTGAPAAPVFLT
ELQSQDVPDGYPVSFDCVVIGKPPPTVRWYKDGKLLEENDHYMINEDQEGCHQLIITSVL
PTDMGVYRCTAENSSGIAATKAELRVDMSCSSDYDTAADATETSSYVSAKGYVSSRETET
FESVSEDDQLPQVVHELHDVHVSSGSPIAKLQLKVKGFPKPRVYWFKDSQPLQPSERIQL
LAERDLHAVEILEVKREDMGEYSAYISNAAGSAYSSARLIVLSPGEIMPQDKKGKKDSKE
PLVPPRFIERFSNRKVKQGASITLSVKVEGSPTPVVSWLKEKSSEDALWIKPDTKGYKIA
SSGRQHSLILMDVDKEYSGIYTCIATNRAGQSLCNAQFEVDDTPQLKKNTAASEILGITV
RPPQEEAGRGSGKNTIKYKQQIIKFFLLLESKIPYLGEVGTEEFLMKLTSQITEMVSAKI
TQASLRVPGVDSDDETKTPSPSPHHGRSRPPSLIADSSSESDDGDARGEMFDIYVASADY
NPTIASKDSISLKEGQYVEVLDSAHPLKWLVRTKPTKTTPSRQGWVSPAYLDKKLKLSAD
AGELPETSVEEVSEGEYKRKLFQLMQDLINGESEFIKEVEFFTSHHMKHADSPDAPPDIC
SQKEAIFRNVDDIKSFHSKTFLPKLHDCDTDDDVAMCFLKNKEGFEHYLQYLVGQSQAES
AVSDKTIHRFFKEYSEKEQATAGPGDPPVRSINAYLQQPLERIQKYKAFLKDLIRNKARN
GQNCCLLEEAYAMVSALPQRSDNTHHVSLIENYPATLEVLGEPIRQGPFQVWEGAPGIRT
SSRGHHRHVFLFRNYCIICKPKRDSNTETQAYVFKNMMKLNNIDVNETVEGDDRAFEIWH
EREDSVRKYTLQARTVIIKNSWLRDLRELQQRYSITAWSSPDFVEILANCTAELGQTIKL
ACKATGVPKPVATWYKDGRTVEADPHHIIIEDPDGSCTLILDNMTADDSGQYMCFATSPA
GNASTLGKVTVQVPPRFVNKMRNAVFVAGEDAQFTCVIQSAPNPKIRWFKDGRLLTDQEK
YQTYSEVRSGVLVLVIKNLTERDLGHYECELSNRLGSAKCAADLVVPSAVVRSGEQ
Download sequence
Identical sequences M3ZU72
ENSXMAP00000005765 ENSXMAP00000005765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]