SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006505 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006505
Domain Number 1 Region: 49-265
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-59
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 250-382
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-26
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 3 Region: 419-487
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.44e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 442-601
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-17
Family Pleckstrin-homology domain (PH domain) 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006505   Gene: ENSXMAG00000006481   Transcript: ENSXMAT00000006513
Sequence length 605
Comment pep:novel scaffold:Xipmac4.4.2:JH556720.1:1229367:1240618:1 gene:ENSXMAG00000006481 transcript:ENSXMAT00000006513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEGKALGGRASRYSCEWNKATAREENGCLVSQADNNEEGEEKMNESGGSESKSEDDKEQ
KLYRIANELLQTERMYVARLHLVDQVFCLRLTQEADRGSFPPDVIKNIFSNISSIYSFHS
QFLLPDLENCIMHWHESPGLGKVLLQHAPFLRMYADYIRNFDRAIELVRTWTERSSAFRN
IIHDIQSQELCGNLTLQHHMLEPVQRVPRYEMLLKDYLKKLPDDDPDYELANKSLEAISM
AAIHSNSAIHKAENLKRLLEIYEMVGEEEVVNPANEFLKEGRLLKLAARNTSAMERHLFL
FNNFLLCCCAKFSLVGQRFTVRCRIGVDGMQTQQTTNEDHLYTFQVSGKEKTLELQASSE
QERDDWIKAIQEAIDVFQKKNETFKLASKEPTEETSQTGPCKTTLRYIPFVQELGRRAPR
WIRDNEVTLCMTCQEPFNALTRRRHHCRACGYVVCWKCSDNKVALEYDGNRLNKVCKACY
SVLAGQRAERMERKKRRMLECGAHPGSMDCVLSGFLQYGDNSTIWQEVWCVLSGTHPPFF
HVYNTPQDEKPLLTVPLLSCVIEELQDQNHFGLRQSNTSHVFSCDDLDVKQNWLTVLKLA
VMRSL
Download sequence
Identical sequences M3ZWB1
ENSXMAP00000006505 ENSXMAP00000006505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]