SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006558 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006558
Domain Number 1 Region: 800-1095
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-68
Family Protein kinases, catalytic subunit 0.00000875
Further Details:      
 
Domain Number 2 Region: 513-809
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.4e-47
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 3 Region: 381-482,518-543
Classification Level Classification E-value
Superfamily SH2 domain 1.33e-21
Family SH2 domain 0.0016
Further Details:      
 
Domain Number 4 Region: 259-368
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000135
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 5 Region: 134-246
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000649
Family Second domain of FERM 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006558   Gene: ENSXMAG00000006506   Transcript: ENSXMAT00000006566
Sequence length 1106
Comment pep:novel scaffold:Xipmac4.4.2:JH556736.1:1658644:1673672:-1 gene:ENSXMAG00000006506 transcript:ENSXMAT00000006566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMNFREEESTPLVLRDRGGSQKSSSSMEVGLQVHIYFFPGTKEATVIQISSGQISAENV
CIQAGKKSGILPVYLSLFGLASADLSFWYPPSHMFDSDENLVVHFRVRFFFGNWFGQGPR
TSYRYSLTKDRISLVLDYNVIDYLFAQLRSDFIASEAGIVPPLSAQEECLGLAVLDLWRM
AKERRQTIRELCKTVSYKSCLPKSHRHEIQKRNRLDRFRIRNTLKRFLKKLGKCSVDEYS
LKLKYLIELAGIEPSLGSETFRVNRSSSHSEATFTLLRVCGETGIQTGQLDGALEWQTFC
DFHEIVDISIKRILNEMVPQDSRMVTITRKDDRCLEASFQSRKEALSFMSLIDGYFRLIT
DSSHFFCQDIAPPSLLEGLKNYCHGPITSEFAVNKLKRSGCTGGTFLIRQSPKNYKNFFL
TVCVQTPLGLDYKDCLITKNESYSLPGLTKSFSSLRELTNYYQHNKLLLAEIPVKLTRCC
PPRPKELTNLIIVRNSSLFEAQGSPTPERNKFSHIQIHMIKFGDLNWGDSLGQGTFTRIF
KGYKTDIRDGGKHMTEVILKELDSAYKNCWESLFEAASLMSQISHKHLLHVYGVSVHESQ
NIMVQEFVKYGALDLYLKRGTSVSVSWKLSIAKQLACALNFLEEQNIVHGNICAKNLLLA
REGDPSLGSTPFIKLSDPGISVVMMGNDVILDRIPWVAPEVLDAPDNLTLECDKWSFGAT
LWEIFNDGNSPLRGWNLDQKRNFYENMHQLPPSQWTELADLITQCMDYDASFRPSCRSII
RQLNSLITSDYVILHATEPVTQSPMSKALNLVPHDQTLFEERHLCYISPLGKGNFGCVEL
CRYDPLGDNTGELVAVKKLQHNKGSNLEDFQKEVKMLSVLHCDYIVKYRGVCYSMGRLSM
SLVMEYLPYGSLNGYVWTNRHNITTRRMLLFSSQICKGMEYLQTQRYVHRDLAARNILVA
NELLVKIADFGLTKVLPFDKEYYRLSQPGQSPLFWLAPECLNENKFSHKSDVWSFGIVLH
ELFSYCDNSINPKRLCLQEIGENVQGTSLSMHLANMLASNWRLPAPPRCPLQVYSLMKDC
WTYDFDKRPSFSDLSKKVENMIQDDR
Download sequence
Identical sequences M3ZWG4
ENSXMAP00000006558 ENSXMAP00000006558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]