SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006629 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006629
Domain Number 1 Region: 84-293
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.02e-61
Family DBL homology domain (DH-domain) 0.000037
Further Details:      
 
Domain Number 2 Region: 278-399
Classification Level Classification E-value
Superfamily PH domain-like 2.08e-28
Family Pleckstrin-homology domain (PH domain) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006629   Gene: ENSXMAG00000006610   Transcript: ENSXMAT00000006637
Sequence length 901
Comment pep:novel scaffold:Xipmac4.4.2:JH556816.1:688603:706435:1 gene:ENSXMAG00000006610 transcript:ENSXMAT00000006637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGEGKRPVSLVSTLSSGSSADSQSLFGRQAESQSPHLKSSGGGWRRHLEACVINNQRNNN
ASASRLARGKFLHMTASPVVTDTMAPNPKLTYVDRVVMEIIETERMYVTDLSSIVEDYLA
HIIDLRNLPIGHEQVMALFGNIEDIYEFNSELLQCLDMCENDPVAIAHCFVNKSEYFEIY
TKYCNNYPNSVATLTECMRNKTLAKFFRDRQAALKRSLPLGSYLLKPVQRILKYHLLLQE
IAKHYDPDEEGYGVIKEAIDTMTRVAWYINDMKRKHEHAVRVQEIQSLLINWKGADLTTC
GELVLEGTFPVLRAKNTRTLFLFEKMLLITKKRGEHYVYKIHISCSTLMLLDSAKDPLLF
SVIHFKRPKQPHTVQAKSVEEKRLWAHHIKRLILENHSTILPQKAKDATVDNCNYSGKCQ
RSPERMMKAECFQSDSFHLRVRNGRRRSEPVKEIIKSTNGKRKRGGAGAGEGNRGTGGGR
KSQKKQTALPMQVFNCNSYPQTNRVPQAEPINQLEVENSHCHDSTMFSSEQQTETPESLD
TSTETAGEEEGESISSGLQVEEMRVLLNGDLSEEEEEVLSDNKSSLPSSVLDQLTAEQLI
SSLSRRSSLVSEDLSLDKDPFQSLSAHMDVEKQMEKMSDSSSPEPQPSSKANLLGPEPEL
SEGERRSTLSKKDQLLIHKIRQYYEHAEHQDANFSLKRRESLSFIPAGLVRQLSRQLNDV
PKEKAGPAYRKGLCRNRPTSWSVFDLPGLEKGKMSEPQSSEEEFRPSSEMLKVWEVMETE
EEIQEVKQEAEDLDTIEVKNSNQPPVIEEEPEMCSAADTCSVSSPTASSSTAEQGSAQLS
EPCSSPAFQENDNFHPGHLSKSISFQTTIDEDQILHDMGKMRNKVFQMARQYSQRIKNNR
P
Download sequence
Identical sequences M3ZWN5
ENSXMAP00000006629 ENSXMAP00000006629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]