SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006688 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006688
Domain Number 1 Region: 94-308
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-59
Family DBL homology domain (DH-domain) 0.00000000397
Further Details:      
 
Domain Number 2 Region: 293-447
Classification Level Classification E-value
Superfamily PH domain-like 9.65e-47
Family Pleckstrin-homology domain (PH domain) 0.000000129
Further Details:      
 
Domain Number 3 Region: 8-111
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-20
Family SH3-domain 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006688   Gene: ENSXMAG00000006663   Transcript: ENSXMAT00000006696
Sequence length 514
Comment pep:novel scaffold:Xipmac4.4.2:JH556995.1:253934:272160:1 gene:ENSXMAG00000006663 transcript:ENSXMAT00000006696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LISGGSVVNAEAVWDHVTMADRELAFKAGDVIKVLDASNKDWWWGQIDEEEGWFPASFVR
LWVNQEDGAAEPAEGTSEVQNGHLDPTNDCLCLGSPLQNRDQMRANVINEIMSTERHYIK
HLKDICEGYLRQCRKRVDMFNDDQLKVIFGNIEDIYRFQMGFVRDLEKQYNTEEPHLSEI
GPCFLEHQDGFWIYSEYCNNHLDACMELSKLMRDGRYQHFFEACRLLQQMIDIAIDGFLL
TPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQW
QASVLDWEGDDILDRSSELIYTGELSWIYQPYGRSQQRVFFLFDHQLVLCKKDLIRRDIL
YYKGRIDMDRYEVRDAIDGRDDDFNVSVKNAFKLFNKDSEEIHIFLAKKPEEKIRWLRAF
HEERKMVQEDEKIGFEISEYQKRQAAMTVRKVTKQKGVNRCTPPSYPPPQDPLSAGQYEV
TEDMAQGEVFEFSQSKRGQGPFWQNFSRLAPFKK
Download sequence
Identical sequences M3ZWU4
ENSXMAP00000006688 ENSXMAP00000006688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]