SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006870 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006870
Domain Number 1 Region: 17-115
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.4e-32
Family Ras-binding domain, RBD 0.0026
Further Details:      
 
Domain Number 2 Region: 156-260
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000849
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006870   Gene: ENSXMAG00000006861   Transcript: ENSXMAT00000006878
Sequence length 305
Comment pep:novel scaffold:Xipmac4.4.2:JH557240.1:5379:20184:1 gene:ENSXMAG00000006861 transcript:ENSXMAT00000006878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEPQTKADKIKVALDKLKEAKVKKLIIKVLMSDNSSKTLMVDERQTVRDVLDTLFEKTH
CESSIEWSLYETNPDLQTERAFEDHECLVEPLSAWSRHSENKLYFLSTPQKYMMFTEPQI
FYMWKKKKSSSDMNSQAKELLIKEHFGGSTTIVPNLEGVLYLKEDGKKVWKPRYFMLRAS
GIYYVPKGKTKSSTDLACFVRFEKVNVYTASSYKQKYRAPTDFCFLLKHPCIQKESPYIK
ILCCEDKHALLLWVNSIRIAKYGAALYKNYQAAVTRASALQIPCSAANKEKSNSATSLES
PYPSS
Download sequence
Identical sequences M3ZXC6
ENSXMAP00000006870 ENSXMAP00000006870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]