SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000006926 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000006926
Domain Number 1 Region: 44-796
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.94e-272
Family Motor proteins 0.000000000161
Further Details:      
 
Domain Number 2 Region: 1259-1356
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-29
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 3 Region: 1439-1560
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-19
Family Pleckstrin-homology domain (PH domain) 0.0078
Further Details:      
 
Domain Number 4 Region: 1842-1910,1970-2004
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-18
Family Second domain of FERM 0.007
Further Details:      
 
Domain Number 5 Region: 1377-1432
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000498
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 
Domain Number 6 Region: 1222-1260
Classification Level Classification E-value
Superfamily PH domain-like 0.00000126
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000006926
Domain Number - Region: 816-946,1262-1287
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000105
Family BAR domain 0.019
Further Details:      
 
Domain Number - Region: 1751-1834
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00878
Family Ras-binding domain, RBD 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000006926   Gene: ENSXMAG00000006838   Transcript: ENSXMAT00000006934
Sequence length 2115
Comment pep:novel scaffold:Xipmac4.4.2:JH556671.1:3935730:4059442:-1 gene:ENSXMAG00000006838 transcript:ENSXMAT00000006934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNFFTEGDRVWLREEEQFLPGCVSSCSGGVVVFATDYGQVYTYKQNALTRQKVQPMHHS
SVRGVEDMATLEDLHDGAIMHNLYQRYHQRQIYTYIGSILAAVNPYQPLPGLYDRPTIEL
YSRHHLGEISPHIFAVANDCYRSLWRRQQNQCVLISGESGAGKTESTKLILRFLSAMSQH
SLEVSCRDKTSHVEEALLESSPIMEAFGNAKTVYNNNSSRFGKFVQLHFNQKGNIQGGRI
VDYLLEKNRVVRQNPGERNYHIFYAILSGANNQQREAFGLTRPESYHYLRQSNCMEDKTI
NDSGTFQDVLNAMQTMQFTEENIREILRLLAGILHAGNIEFMTAGGAQVASKSALSWTSE
LLGLNSDQLAEVLTHRSMILRGEEISTPLTVEQAVDSRDSMAMALYSQCFNWIIHKLNHR
IRGKEDFKSISILDIFGFENFEVNRFEQFNINYANEKLQEYFNKHIFSLEQLEYNKEGLV
WVDINWMDNGECLDLIEKKLGLLALMNEESHFPKATDDTLLEKLHSQHSKNPFYVKPRVA
VHLFGVRHYAGEVVYDVRGMLEKNRDTFRDDILNMLRESRLDFVYDLFEHVLSRNKQDTL
KSSTKHRRPTVSSQFKDSLHSLMATLSTSNPYFIRCIKPNTHKMPDQFDQTVVLNQLRYS
GMLETVKIRRSGFPVRRSFQDFCSRYKVLMRGVLTPDDPRGRCKQLLHLYDSSSADWQLG
KTKVFLRESLEQRLEKQREVEVLKAAMIIQAHVLGYVARKQYRKLLQCIVVIQKNYRAFY
WRRKFLLLRWAALTFQKRLRGQLARRAVGRLLDERRKRKEEEERRRKMEEEMERERLRLE
AERRAKEAEEVLRLEELQRTMELQRTMELQRTMELQHAQELQHAQELQRAMELTSLVFTQ
SQLEEAAAALPETPEELESVFEEAAEEEEAIRPQEASQVEEILRLEREIQALQRQKEQQE
LSLTEASLHRLQRLRDQELQRLEDEACKAAQQFLDSLNFDEIDECVRNIESSLGVGEEEE
KENGGRRGNDEEEVDEGFGADDEAFKDSPNPSEHGHSDGQRTSGIRTSDDSSEEDPYAND
VPIPAMPLTTLLHQPLPPLPPAAHSVSSSGDSAFCHPQASSEAPSDDLVELIPPDEDSDY
DQDDYDEGAIVSSGSVAFSSSRSGQWSPDYRGSVGTYNGSGAYRFSSEGAQSSFEDSEDD
FDRFDTDDELSYRRDSVYSCVTLPYFHSFLFIKGGLMNTWKRRWCVLKDETFLWFRAKQE
ALKQGWLHKKGGGSSTLSRRNWKRRWFVLRQSRLMYFENDSEEKMKGVLDMHSAKEIVDN
TGKENGIDIVMPERTYHLIAESAEDASQWFSVLSQVHGSTEQEISEMHDEQANPQNAVGT
LDVGMIDSVCASDNPERPNSFVIITAERVLHCNADTPEEMHHWITLLQRSKGDARVDGQE
FIIRGWLHKEMKNSTKASLKLKKRWFLLTHNSLDYYKSSERNALKLGTLVLNSLCSVVQP
DEKLYKETGYWNVIVYGRKHSYRLYCKLLNEATRWASSIQNVIDTKAPIDTPTQQLIQDI
RENCLNSEVVEQIYKRNPILRYSHHPLHSPLLPLPYGDIQLSASRSRSYTTLQDEALRVF
GSLQHLDGVADPVAIIQGILQTGQELKPLRDELYCQLIKQTARPPQPGGPGNLCSWKILA
CMCCTFMPSRSVLRYLKFHLKRTRELFPASEMDRYAAFAFDSLKKTRSRENVPSQEEIRS
IVARQDMSTTVHCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEHNDASEK
AIESRTVVADVLAKFEKLSASSEESNTGWRLYFKLYCFLDTDGVPKDSVEFAFMFEQAHE
AVIQGHYPAPEETLQFLAALRLQYLLGDQNPQSTVPEMSQVFPMARLRTRVQNSAKTFSG
AGSVAERSGTAERKRSSFLEGTLRRSFRSGSLSRQRLEEENSLEAWLREEAAAVRTSVLD
KWRKLQGVSQQQAMVKYMALVKEWQGYGSTLFNVESRDGAFPAELWLGVSRESISVYKRG
EPWPLEVFPYELILSFGAPLPNAYKIAVEGRELVFETQMVMDIAKLMKAYISMIVKKRHS
NSQSVSSHESKGSAW
Download sequence
Identical sequences M3ZXI2
ENSXMAP00000006926 ENSXMAP00000006926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]