SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007222 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007222
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily PH domain-like 9.95e-48
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000589
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000007222
Domain Number - Region: 208-287
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.00141
Family Tubulin chaperone cofactor A 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007222   Gene: ENSXMAG00000007184   Transcript: ENSXMAT00000007230
Sequence length 358
Comment pep:novel scaffold:Xipmac4.4.2:JH556767.1:663547:693119:-1 gene:ENSXMAG00000007184 transcript:ENSXMAT00000007230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEQPIYSTRAHVFQIDPNTKKNWLPASKHAVTVSYFYDSTRNVYRIISLDGTKAIINST
ISPNMTFTKTSQKFGQWADSRANTVYGLGFSTEHHLSKFAEKFAEYKEAARLAKEKSQEK
MEMATSPSQESPAGELASPLTPLTPPMENINGTDEICDTTPNSDSRPEPAQNALAFAHSP
AMTKHWEAELEALKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECQSN
QTPVIKSQKTELNQTIEELENVLRDKEEEMEKLKEELENMNDLMEQKDTLTQKLEETELR
SRVLEEQLAGAEQRLEENQEEQENFRKSLRTLLELLDGKIFELTELRDTLARLIEEAS
Download sequence
Identical sequences M3ZYC8
ENSXMAP00000007222 XP_005804049.1.87360 ENSXMAP00000007222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]