SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007320 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007320
Domain Number 1 Region: 1225-1387
Classification Level Classification E-value
Superfamily PH domain-like 5.88e-72
Family Pleckstrin-homology domain (PH domain) 0.000000224
Further Details:      
 
Domain Number 2 Region: 1001-1228
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-51
Family DBL homology domain (DH-domain) 0.0000000171
Further Details:      
 
Domain Number 3 Region: 434-536
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 826-902
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000011
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007320   Gene: ENSXMAG00000007277   Transcript: ENSXMAT00000007328
Sequence length 1572
Comment pep:novel scaffold:Xipmac4.4.2:JH556673.1:1402813:1453319:1 gene:ENSXMAG00000007277 transcript:ENSXMAT00000007328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNTESQNGEHALYSTGRGYLSRKHMSRSLRISNKQSRRSRHASSGKMEHRNSETSTRSS
STPSIPQSLADNGLEPFNETNNFPDFGSPIWVDRVAMSLRPISFHNDLANPSVHMNTMHI
TLPGPTAEETQDEEVYTNEVKYIQQTLECSKETISFKKRSKSADTWRDDSLEFSLSDVSQ
DNLTSTEEIIDMANERDFADCEGHMQFSPTDSADRANSLDELYSDTSPASRIHGRYAKWH
DTNRSVGEGDDGKRLSPSEEDGTSYSAYTLPCRRSHCLSEGLSNLQATMCKSMQGRRAQT
IQDVTAGDGSEYEDSGIDGVMVEAVHQPRRYKTMSASFSVCSMHGRNVFVGSDSGSSSGG
GGASEGVQGVYENFRQELQMSSCQTESLEEAGSALSDEQSTMSSAYQSDLLLSVVQGMVR
KAGKLAVKNFLVHKKNKKVESATRRKWKTYWVSLKGCTLFFYETDGRSGIDNNSIPKHAI
WVENSIVQAVPEHPKKDFVFCLSNSLGDAYLFQTCSQTELENWITAIHSACATAVARQHH
REDTVRLLRAEIKKLEQKIDMDEKMKKMGEMQLSAVTDTKKRKTILDQIFLWEQNLEQFH
MDLFRFRCYLASLQGGELPNPKRLLAFASRPTKLTMGRLGIFSVSSFHALVAARTETGVR
RRTQAMSHSCKRKSRFSSLWGVDTTSKKKTKAHPTVSQVFADGEEPEKKTVDRIFVDSGK
ENTKTEDGTVKNLVRPNTDSDMWVPENLTPSWVCLPNDQPVLTTIQPGESALCVLESICK
THELDPTKHYLRLKFFMENQTQFYIPKPEEDIYDLLYKEIELCSKITKVIQFDRDESCMI
GYGFSISVVEEDGVQQLYITDVKAGGLAFAKGLNAGDEILQLNGKDSHSLNFSDMKAAFS
QVSLALTVNTLPSVDRRQLCYLPPRRSDAAEDLYTDIFSQSQDAEEILDDGVGLLLESSG
DSLDDDSEIFSEFDECGKSTEQVAAFCRSLHDMNPSECVSSSPSPDSPFPPTATPRQLSD
ADKLRKVICELVETERTYVKDLNCLIGRYLTPLQKENFLTQDELDVLFGNLPEMVEFQVE
FLKTLEDGTRLVPDLEKLESVDQFKKILFSLGGSFLYYADRFKIYSAFCASHTKVPKVLV
KAKTDPNFKAFLDERNPKQQHSSTLESYLIKPIQRVLKYPLLLRELYSLTDPDSEEHYHL
DDIVAIKAMNKVASHINEMQKIHEEFGAVFDQLITEQSSEKKDVADLSMGDLLLHNTVTW
INPPISLGKWKKEPQMATFVFKTAVVFVCKEESKQKKKIGGSHRVSVSSEEKDPFRFRHM
IPTDALQIRSMSNTDGESSAMCEIVHTKSESEGRPERTFHLCCSSPEGRKEFLKTVHSIL
REKHRRQLLKTESLPLNQQYVPFGGKRLCALKGARPAINRAASAPTRTLGRRKLVRNRFT
IDTDIVFVPLQQKEEQQSELAGDTDRWVEEQFDLEEYEDQEEMKETDILSDDDDEFCQTP
RPPSEEVDLESPLMALSLEGTETDGSKSLPSPTVSDTPDEEKISDTERKSSVTDNSEDKN
QAEKAEVWVRRE
Download sequence
Identical sequences M3ZYM6
ENSXMAP00000007320 ENSXMAP00000007320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]