SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000007964 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000007964
Domain Number 1 Region: 349-709
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.62e-114
Family Oxysterol-binding protein 0.0000215
Further Details:      
 
Domain Number 2 Region: 45-149
Classification Level Classification E-value
Superfamily PH domain-like 4.29e-21
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000007964   Gene: ENSXMAG00000007933   Transcript: ENSXMAT00000007972
Sequence length 715
Comment pep:novel scaffold:Xipmac4.4.2:JH556740.1:753151:760479:-1 gene:ENSXMAG00000007933 transcript:ENSXMAT00000007972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGETAAVRVAENEGKVDAFPPNRTPSSGRAGGKSWQYSDHMENIDGYLMKYTNLVTGWQ
YRFFVLNNEAGLLEYFVNEQSRSQKPRGSLPLAGAVISPSDEDSHTFTVNAISGEQYKLR
ASDAKERQHWVSRLQICTQHHTEALGKSNPAPSRRYSVASQSSASSPMSLRRPSQSTSAL
FGWTQNHKGSVYSSRKSLMPDHLLDAREMMSQAQGQHRDLIQSIEGLPAAPGPGLSPLDQ
DLLMLKATSMATMSCLSECLHILQLQQVARQRAALGGPTIEWLEPKVADEVLKNGSSPLG
NHTPLEGGRLPLSAPDACSCSEEQEEVDPEDEVEDSFMDTEEDLGAVEEERSVILHLLSQ
LKLGMDLTRVVLPTFILEKRSLLEMYADFMSHPELFVTVTDGNSPEDRMIRFVEYYLTSF
HEGRKGAIAKKPYNPIIGETFHCSWRVPRGPEALQGEAEPPAEAPEPYQVRFVAEQVSHH
PPVSGFYAECPERQMCVNTHVWTKSKFMGMSIGVSMIGEGCLHLLEHDEEYTFTLPCAYA
RSILTVPWVELGGKVNIACNKSGYSAVITFQTKPFYGGKLHKVTAEVKHNSTNAVVCRVQ
GEWNGVLEFSYTSGETKVVDVTKLPVTRKRVRPIEKQAPTESRRLWQHVTEALRQKDIDK
ATEHKRVLEERQRAEERQRAETETPWRTRYFDREGEGWAYSKPLWKNSKSYVSCL
Download sequence
Identical sequences M4A0H0
ENSXMAP00000007964 XP_005802595.1.87360 ENSXMAP00000007964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]