SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000008297 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000008297
Domain Number 1 Region: 81-396,436-717
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.31e-112
Family Acetyl-CoA synthetase-like 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000008297   Gene: ENSXMAG00000008269   Transcript: ENSXMAT00000008308
Sequence length 719
Comment pep:novel scaffold:Xipmac4.4.2:JH556808.1:699619:730264:-1 gene:ENSXMAG00000008269 transcript:ENSXMAT00000008308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLKEDLNPMLLLLFHLTVWIYTTITFLPSYLLSWVSRSHRNFYGSEEERAKRPKACSVL
GRSEGPYRAVSATKRLLSSLHPGVDTLDKMFEYAAMRFPQRDCLGTREVVTEEDERQSNG
KVFKKVVLGEYRWLSYKEALTAATQLGNGLASLGQRPKTNIAIFCETRAEWLIAAQACFA
YNFPVVTLYSTLGGPAIAHGLNEAQVTHIITSRELLETRLKAILAEVPRLQHIIVVDNTP
TTWPGFPRGISIYNMATVQKLGARPDKATFERKQPLSSDIAVIMYTSGSTGIPKGVMISH
SNIIASITGMAERIPNLSEEDTYIGYLPLAHVLELCAELVCISYGCRIGYSSPQTLADQS
TKIKKGSRGDTSVLMPTLMAAVPEIMDRIYKNVMTKVEEMNSFQRTLFILAYNYKLEQLS
KGYSTPLCDRLVFRKVRSLLGGRTRVLLSGGAPLSAATQRFMNVCLCCPVGQGYGLTETC
GAGTICEHWDYSTGRVGGPLVCCEIKLRDWVEGGYRSTDKPHPRGEILVGGPNITMGYYN
CEAKKQEDFFVDENGQRWFYTGDIGEIHEDGCLEIIDRKKDLVKLQAGEYVSLGKVEAVL
KNCPLVDNICVYANSDETYVIGFVVPNQKQLLALAGQYGIRGSWEELCNSKAMEELVLKV
ITEAALTAQLERFEIPRKIRLSPEPWTPETGLVTDAFKLKRKELKTHYKDDIERMYGGK
Download sequence
Identical sequences M4A1F3
ENSXMAP00000008297 XP_005805933.1.87360 ENSXMAP00000008297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]