SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000008302 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000008302
Domain Number 1 Region: 16-213
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 8.63e-41
Family Regulator of chromosome condensation RCC1 0.0066
Further Details:      
 
Domain Number 2 Region: 1374-1436,1468-1651
Classification Level Classification E-value
Superfamily VPS9 domain 1.7e-38
Family VPS9 domain 0.0027
Further Details:      
 
Domain Number 3 Region: 517-679
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.62e-27
Family Regulator of chromosome condensation RCC1 0.046
Further Details:      
 
Domain Number 4 Region: 1038-1130
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 8.11e-19
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0042
Further Details:      
 
Domain Number 5 Region: 1137-1243
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 7.32e-18
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.013
Further Details:      
 
Domain Number 6 Region: 887-1001
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000105
Family Pleckstrin-homology domain (PH domain) 0.099
Further Details:      
 
Domain Number 7 Region: 687-887
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000000055
Family DBL homology domain (DH-domain) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000008302   Gene: ENSXMAG00000008272   Transcript: ENSXMAT00000008313
Sequence length 1654
Comment pep:novel scaffold:Xipmac4.4.2:JH556740.1:1547168:1562166:1 gene:ENSXMAG00000008272 transcript:ENSXMAT00000008313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INVLFSSSSEDDDGGERGLLHSWRGYSYSVVPERLLLPRPVLQVALGAQHGVLLVEGGQV
YTFGELPWKQTQASQPTKPTPENALSGQRVVAVAAGSFHSGAVTEDGSVHMWGDNAAGQC
GLSGLSCVPNPTPVALLEPGGAQSVPVLELACGEKHSLALSAQREVWAWGSGCQLGLKEA
VFPVWKPQKVEQLAGRWVLQVACGASHSLALVRCVGPDGIQRPPVDKCNQCNQLLYTMTD
KEDHVIISDGHYCPMGVEAREDPPPTQTLKASPSEPILPSHSSSTSTPAAPTPDPTPDPE
DSQKGGTTTAARPPSDPDPPPSPKAAASTSSSKSSPYPGEKEVKEYLRKLSDASQTEVFF
SSFPSHQAPPSGVFFSSFPSHQAPPSGRGQSALNSLVASCASAVGERVASTYEALSLKRM
MNFYLPSSRLEALGGAADGGAERVRREESVQAKKSSSTGDIHEEEAEGLRRRLSLPGLLS
QVSPRLLRKMGRSRTRAFALTPMGGGVPEDQEVFPTLQTEVWSWGHGEQGELGHGDNLDR
LQPFCIKSLNKKEVIRVSAGAHHSIALTAQSQVYSWGSNLSGQLGHMDTPSTVPRLAKLS
EGIRVWDASAGERHTLLLADGDCIQPIIYYSGQQEEEEEDERPGGYTQQPVLLPFCMNLG
FVSSVVAGGRRCVALSDRNVMGFISSLHELASAERKFYCKLCDIKSQVLRPLLELESLSS
ALGPAATELLQTLAGRFSLLSHLTGQHGASLTANLRRGRDVSSLLMLEHASIFLDVYNDY
CSTVGNFFVMGGFHALTKPSLDIFGKSPELLQRLSECSEENTVTSDLLVALFYLPTQHLH
EYGRLLLKLATCFEVSSGDYQKLQDSCSKFEALTLQLKRKRKEAEYTFHFWKSFPGKMTD
SLRKPNRRLIYESSNKSLTVQNAGRFSVNWFILFNDSLVHAQFSTHHIFALATLWVEPAP
EDNSGLHGLKVVTPEETLTLLASSSAEKTKWLRAINQAVDQALSGAGQDASGPASKSDPP
ISRTASYTFYKDGRLKDATYEGRWLAGKPHGSFRGILKWPDGRIYTGSFKSGLEDGFGEF
ACPNKALNQGDLYQGYWKEGKMHGLGTYRYASGEVYDGSFQDGMRQGHGMLRSGKHNTSS
PSVFIGQWLQDKKTGYGVFDDITKRGEKYMGMWQDHQRQGTGVVVTQFGLYYEGAFKDNK
MMGTGILLSEDDTTYEGEFSDDWTLSGKGVLTMPNGDYLEGSFSGEWGSGLKVTGSYFKP
NLFDAEKDRNRAVFRKLGRMSVRAEEKWQAVFEECWSELGCEAPGEGEHLKAWENIAVAL
TSRRQQIQDSPEILSRSHSKTLEGLEVIPQHEGPITIERYHSIRLYLLKACDTPLHPLGR
LLETLVAVYRMTYVGVGANRRLLPQAVNEIKSYLCRIFQIVRFLFPDLPEEGGLIPEPAE
NLPDGNQEMSADTRTESPKPGRVVSSSALLLPVLLPRLYPPLFTLYALEKEKEDDMYWEC
VLRLNKQPDLALLAFLGVQQKFWPVSIPNSLPAPGGKQPVASSTKDACFASAVETLQQIS
TTFTPSDKLQVIQLTFEEITQEVQSLLKQDFLWSMDDLFPVFLYVVLRARIRNLGSEVSL
IEDLMDPCVQHGEHGIMFTTLKACYYQIQHEKIT
Download sequence
Identical sequences M4A1F8
ENSXMAP00000008302 ENSXMAP00000008302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]