SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000008324 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000008324
Domain Number 1 Region: 134-339
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-56
Family DBL homology domain (DH-domain) 0.0000665
Further Details:      
 
Domain Number 2 Region: 356-480
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-16
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000008324   Gene: ENSXMAG00000008297   Transcript: ENSXMAT00000008335
Sequence length 521
Comment pep:novel scaffold:Xipmac4.4.2:JH556892.1:799660:805554:1 gene:ENSXMAG00000008297 transcript:ENSXMAT00000008335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVEETGEMRTSWSVSGDTHSVLCDHAGKKRKQDLNPERVIRITEDEEEEEEGEMMSDHK
DSEEPSNKKVKPVAKSNSLTGVITPMKTAALKRIGQSISRSISFRTDARPLPPGPLRPRS
KASSFPRRRNSQCWSDTVESHDLTAKEIKRQEVIYELTQGERQLIEDLSLVKKVYYEPML
KLDILTESELGQIFGTLDSLIPLHEDLLARLERLRGSEKTVGEVGPTLLNWFPCLEAYVT
YCCNQVGAKALLDQKKQEKRVDQFLRLCQESSFSRKLDLWNFLDLPRSRLVKYPLLLKEI
QKCTPPDHPDEDTLPDALEMIQSIVAEVNEKTGEAECQFYRRGLVYLEESQRIPEIHQSR
FLYCHGELKTNKGQKLHVFLFELALVLTRPGDDRDIRGQMFNVYRQPLPNTLINLEEIPD
SEAGGGGTFRGAFTGGNDKVKNCFRVSSRGRSKVNPYCLQANDSFSKQQWITCLRQAIVQ
SRDRTAHTSQSPLSLSPDPALCHIADLSLSSDTDMADHTCR
Download sequence
Identical sequences M4A1I0
ENSXMAP00000008324 ENSXMAP00000008324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]