SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000008337 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000008337
Domain Number 1 Region: 166-265
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.08e-32
Family Ras-binding domain, RBD 0.0022
Further Details:      
 
Domain Number 2 Region: 305-418
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000107
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000008337   Gene: ENSXMAG00000008314   Transcript: ENSXMAT00000008348
Sequence length 596
Comment pep:novel scaffold:Xipmac4.4.2:JH556805.1:410544:432905:1 gene:ENSXMAG00000008314 transcript:ENSXMAT00000008348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDIDAMFSDLLGEMDLLTQSLGQEIEPPEPHPSTSHQIDFSVGFTGLNASLHDLEDNDL
DALMADLVADLSETEKKLEAEIQDLPPPPKGLGLQPASSITSPPSPGNNRSSSVTTTSSS
TTSPLPPPPLQSSKPTMVRVLTLEKVSQEEIEAQMKADKIKLALEKLKEAKVKKLVVKVL
MNDGSSKTLMVDERQTVREVLDNLFEKTHCDCNVDWSLCETNHELQLERTFEDHENLVEP
LLAWTRDSENRVLFQERKDKFEVFKNPQNFYLWKRDKKTLKDMKDKDKELLVQENFCGTS
IIVPDLEGVLHLKEDGKKSWKQRLFQLRASGIYYVPKGKTKSSRDLICFVQFDNVNVYYG
KDVKNRYKAPTDFCFVLKHPQIQKESQYIKYLCCDDAWTMNLWVTGIRIAKYGASLHDNF
KTAERKAAVSAAMWTNRSTPSSSSPSTPSPTIKAKAATQANGYAPKQQPGPTHQVNKSPE
EETDGFTNSQSGSFINILPSLLPSFVPFIPLFVYFLFSYFLSYIPSLLPSFVSSFLPIFV
SFLGIGNLPAPPPLNEILPPPPPDPVLPPPPPSLASKPPPSKFPPPPLSMDSLPPP
Download sequence
Identical sequences M4A1J3
ENSXMAP00000008337 ENSXMAP00000008337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]