SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000008896 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000008896
Domain Number 1 Region: 309-496
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5e-64
Family Regulator of G-protein signaling, RGS 0.00000769
Further Details:      
 
Domain Number 2 Region: 703-932
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.01e-60
Family DBL homology domain (DH-domain) 0.00000002
Further Details:      
 
Domain Number 3 Region: 933-1068
Classification Level Classification E-value
Superfamily PH domain-like 4.45e-38
Family Pleckstrin-homology domain (PH domain) 0.00000632
Further Details:      
 
Domain Number 4 Region: 6-84
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-21
Family PDZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000008896   Gene: ENSXMAG00000008860   Transcript: ENSXMAT00000008910
Sequence length 1083
Comment pep:novel scaffold:Xipmac4.4.2:JH556718.1:1953612:1972119:-1 gene:ENSXMAG00000008860 transcript:ENSXMAT00000008910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGLVQRCVIIQKDENGFGLTVSGDNPVFVQLVKEDGAAMRAGVQTGDRIIKVNGTLVTHS
NHTEVVKLIKSGSYVALTVLGRPPGLAQIPLPEAEPDILGVSISSPNSPATERPYSPQDR
FSLFQSSWEENGSACNQRSDVLQKKLSKEQQDLQAMKEEYSRNPSPKLLKDIQEAKKHIP
QLQGQLLKSTETTQVAMQTTVACTKRISHTPLKQTIAQIYPGAALLSKDTMTPESHCPKE
LSYPSPKSTPRNSFNSCHSPETEDTTDLDSLSPSALSSPSCSRVISQIIGAEDDYFGRDQ
EQTNGQCDSFNSIEQLKSRPAHLAAFLHYVISQFEPAPVLCYLHTELYKQTNSKETRRVF
MDLHNFFMDRGANLKVAVPESVSSDLDRRRTELIPEEINRQHVQTLQDSLLADVEKHLED
FRQKRNMGLTVAEAELARLDQERVRDRVTLERERSYAENIISKIDDILLTTQTTEEDKCT
TIQFVIYTYMKHLGVRVKEPRNLESKRGLNRLFPKMKHKSIKTDKEVDDRLKKKFLNLVP
QRRPSRIEAAAFNTTGKNLENRPRPQKQLSQPTLGAVELMDNSRLKGSQSSEGPELTHSL
SVSSPSNTTHSVDANRDADIVSGGTPTSAPSRLSDGLQPDPLDGLAFPDSTELYPMEKLP
EDDRESDRAHDGTPKAVRKLEALGIGDVQSEDDQGTDSELDPHNWQQLVGREVLAGLRPQ
EIKRQEVINELFYTERAHVGMLKVLDDVFYQRLSKDAILPPADIKNIFTNLEEVLQLHVS
ILEQMAAIRKRNDSLVIDLRGDDLLSWFSGAEEEKIKQAVGTFCSNQPFALEIIKTKQKK
DSRFTSFIQEAESNRQCRRLQLKDIIPVEMLRLTKYPLLLDNIVKYTDDPVEKHKVKQAA
DCCRKILSHVNQALKESEDKQKLEDYQRRLDLSSLKQTDNPVILELKNLDLTKKTLIHEG
PLSWKMNKDKTIELYTLLLEDILVLLQKQDERLILKCHSKILAGTPDTKHTFSPIIKLST
VLVRSVATDNKSFFVLSMSDNVAQIYELMAPTVSDQKMWQTLISQRADTMKVKPHSVIPL
PQT
Download sequence
Identical sequences M4A352
ENSXMAP00000008896 ENSXMAP00000008896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]