SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009448 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009448
Domain Number 1 Region: 52-135
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-20
Family Ubiquitin-related 0.0000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009448   Gene: ENSXMAG00000009429   Transcript: ENSXMAT00000009462
Sequence length 278
Comment pep:novel scaffold:Xipmac4.4.2:JH556672.1:3836606:3839384:-1 gene:ENSXMAG00000009429 transcript:ENSXMAT00000009462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTETEAKPTEAEALGENVEKADAESTSLTDAGNATTQDSSISNGDDADDKQETVDLKII
WNKNKYDLKIPVDSTGAKLKERIHALTGLPPAMQKVMYKGLLPEDKTLRDIKVTNGAKIM
VVGSTINDVLAVNTPKEVIQQEVKAEENKKEPLCRQKQHRKVLDKGKPEDIMPSIKGTKE
RLPTVPLSGMFNKSGGKVRLTFKLEQDQLWIGTKERTEKVPMGSIKNVVSEPIEGHEDYH
MMAFQLGPTEASQYWVYWVPAQFVDAIKDTVLGKWQYF
Download sequence
Identical sequences M4A4Q4
ENSXMAP00000009448 ENSXMAP00000009448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]