SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009621 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009621
Domain Number 1 Region: 130-336
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-58
Family DBL homology domain (DH-domain) 0.0000296
Further Details:      
 
Domain Number 2 Region: 321-444
Classification Level Classification E-value
Superfamily PH domain-like 5.21e-28
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009621   Gene: ENSXMAG00000009599   Transcript: ENSXMAT00000009635
Sequence length 1177
Comment pep:novel scaffold:Xipmac4.4.2:JH556893.1:159065:184367:-1 gene:ENSXMAG00000009599 transcript:ENSXMAT00000009635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGSHSSPSRIPMGEESPRLSIASISSDERAPSATPSDPSDPPPSGQRPLSLISTLSSG
SGSSRDDYVAPPPESEASFGVDLNQNPSPEKRGWSFVHNNNNNNKASTPSRASSRRQPAL
PFVGATMVPDPKLKYLDRIVMEIIETERMYVRDLKIIVEDYLAHVIDESDLSNQPKLVCD
LFGNIEDIYEFNSELLQDLERCDNDPVAIASCFVSKSEDFDIYTQYCTSYPESVEALTKC
MNNISVAKFFRDRQASLKHSLPLGSYLLKPVQRILKYHLLLQEIAKHFGPQKEGYDVVEE
ALYTMTWVAWYINDMKRKHEHAVRLQEVQSLLVNWKGPDLTTYGELVLEGTFKVPRARHE
RTLFLFDRMLLITKRRGEHFVYKTHISSSTLLLIESAKDSLSFSVSHYKHLKQTHNVQAK
TVEEKKLWAHHIKRIILENHQAAIPQKAKEAILEMDSIGPARYRYSPERLKKTATDEFPR
DARQGRRQSEPTKQMLKRNKAPLEHAVSEDALAGDGRSLQGAISSSTLGSSSLGEPDGGE
DEAGRLDDFLLEDEQEAEKSCNAATKENDQLSEDELIGPEPTPEQSPDALPQENPLEKPE
DSEPELSAGLDPSVVPEVPQMSEDLQPDEDPEPAELPSSVTFDSDSKTLSSAESSEEEDE
REAADDESSSPSILPSSVLDKASAIAQHFNSIKRGSLAQDDARSLACLSPRLPSRTGSML
SLRSESADRPLRLNSNSSDPPEAFGGADLSLLSPRDDSLFEPDRSVRRRRDSTLSKQDQL
LIGKIKSYYENAENQDASFGLRRRESLTYIPSGLVRSSVSRFNGIPRVETAQSNPPASNT
PQDLDPLSTEPTETKDRLVSSQSLDSLRSDLLSGDCEEPHRFRQTHYDLSEEEFRSSSEM
IKIWQAMERQISRSQSEDRESSRSRETVKPSISAGVSSLTRTKSCDPDLGNSDLSPVTED
SLSPSLPKTRTAALSRAGSQTSTSRCFGEQTVTLRATVPRVAQLRAEAGGDKPTEETEQT
GEVDRAESKVRLLARRYSQRIRTSGPVVRQRSPAGPFNRKTLACVVEEKEGSGKPSLTLP
LGPKVQSKSLPLSPVDPVQNPDAGAPDHASLSPPPIEGFSWPDVRKLRSRYSSGGGRNQN
RPMSRSSTIPDRMLDXXXXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences M4A577
ENSXMAP00000009621 ENSXMAP00000009621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]