SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009759 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009759
Domain Number 1 Region: 356-575
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-58
Family DBL homology domain (DH-domain) 0.0000001
Further Details:      
 
Domain Number 2 Region: 561-713
Classification Level Classification E-value
Superfamily PH domain-like 5.6e-39
Family Pleckstrin-homology domain (PH domain) 0.0000062
Further Details:      
 
Domain Number 3 Region: 282-358
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-19
Family SH3-domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009759   Gene: ENSXMAG00000009729   Transcript: ENSXMAT00000009773
Sequence length 784
Comment pep:novel scaffold:Xipmac4.4.2:JH556681.1:1652073:1678717:1 gene:ENSXMAG00000009729 transcript:ENSXMAT00000009773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKCVSPPLSKREASQQQPDFASIPNEVKSHLQEQESILLTEKVPPAGSSPPPDPPACLS
NSPVLPTPPTDGAAASTETTSVKPRQRSGRPRPRPISDYAQLVSRKHCIPEEVAETNYEE
RTSGAQQQENCSSNGNGSNPDNCSLNGEVQRHRPVSVIGAVDLYSTDTELKEDHLPSLLL
QPLSRPPIPSHKVPPYRGVSARLRPCALSQSTPIGLDRVGRRKLHRVLSAGVSECSATLD
DSVSEEEEEESSFEELADGTPYLQPGVELSVLNEWIISGHAVYAEALWDHVTMEEQELAF
KAGDVIRLLDASHKDWWWGRGGDREAWFPSSFVRVRVNQEDSSTESVESVADQEDPAPRD
KPSTQHREQMRTNVVQEIMNTERIYIKHLKDICEGYIRQCRKNSSMFTELQLKTIFSNIE
DIYRFQRQFVRELEKKYNKEEPHLSEIGSCFLMQGEGFSIYSEYCNTHPAACAELQRLMK
MGKYKHFFEACRLLQQMIDISIAGFLLTPVQKICKYPLQLGELLKYTPKDHRDHTGVSQA
YEAMKKVASLINERKRRLESIDTIAHWQVAILHWEGPDVLERSSELIHSGELTRAVRQGK
PQQRSFFLFDHQLVYCKKDVLRRDLLHYRGRLDMDMIEVVDVADGRDSDLGLTLKNALRL
RHASTLEFMCMLCCRKVEDKQRWLEAFAKERQRVKEDEEMGIDISDEQRKQAIANARRPK
HGKIKTVGYADSVPPHQNLPPLQQRHITIPTSVPQQQVFSLAEPPRRKPYHLLYSITRSA
FFKK
Download sequence
Identical sequences M4A5L5
ENSXMAP00000009759 ENSXMAP00000009759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]