SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009974 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009974
Domain Number 1 Region: 606-795
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-44
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 88-168
Classification Level Classification E-value
Superfamily F-box domain 1.24e-16
Family F-box domain 0.00076
Further Details:      
 
Domain Number 3 Region: 828-966
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000859
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009974   Gene: ENSXMAG00000009965   Transcript: ENSXMAT00000009988
Sequence length 972
Comment pep:novel scaffold:Xipmac4.4.2:JH556865.1:839686:852564:-1 gene:ENSXMAG00000009965 transcript:ENSXMAT00000009988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTGAPHSVSSPDREPQPGPKLVRETRFSSWTPQGNKQSNLQLFEERVKLLLHWFDLWT
DSQRKRLLQALLGRCTKAQLKHCRNLLNDTVPVTRLDFTAVLPRCLSLYIMSFLSPRELC
GAAQVSWHWRVLAEQDCLWAGRCIKRGWFLPYSPRDKEFGAWRNHYVSCVSTLDRLSPQE
AAEIYGTLYQPRLGVKEEEGERSRERRIRQKLKEALKEEKRLALISRRPWGSNPKSDRSG
GERSQTVLSSSELMVRSWPSLSSPMKAVESPTASLSPHRGQHLDEVSRHFASQPKVSSVL
ASTETGLSKAKTVPASLPHTDSAAILLLISNKIPAYEVVLSGVKARVAVVLYDHRWTLSA
LFNQTERAASGQRVQRLGLLVPGGTEEVHLVNGSVLSERTLSSPDHQEFWEKLCALVAPG
QEGGGIDIFCPLAASVPGLALMWNLSDLTGLEVRAPLGFATGSFQNILSEWSGGDQDPAA
PALCYVADSVLLGWCRQARWMEEVLVRLRKSLELQLQQASLQARGRALGLFLWENISLDT
LGACGELSEALTEGLTALSRQNESRPVEFLSSFLMKWSKEDGERSQAAGGSSCPGPPPGI
AQATFDWRCSVGRELLHSERLYLGRMRAVLKVYQEPLMAALNSNRAILSYVDIQIIFGSV
ALILHQNGVFQADLQARLQHWGAEQCVGDVFVKFCSKLNVYTNYLNNYITTIHTIDKCRE
AKPAFRAFLKRADRTLPTHMLSLQELLLCPVWRIQEYVTLLQALTSHTRPGHPDHPDLRS
ALNAVLQFRDFIQEVTELGSTQRLPQVPAKYGNDLCVFQLERNSEADRRLEETQELIRGC
PSLAEGNRQLIITQDAMMLRSPDEQIPDSLRAFEHVCDVGLFLFSDALVLTRRRLQHIPF
TMTHRSTHTFWVSVALSSLDVREVLHTRYVRHAFVLDGPRCSWVCATEQEEERDNFLSAL
RSAISSSLTEHQ
Download sequence
Identical sequences M4A680
ENSXMAP00000009974 ENSXMAP00000009974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]