SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000009994 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000009994
Domain Number 1 Region: 1082-1235
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-55
Family Pleckstrin-homology domain (PH domain) 0.0000117
Further Details:      
 
Domain Number 2 Region: 881-1081
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-52
Family DBL homology domain (DH-domain) 0.000000132
Further Details:      
 
Domain Number 3 Region: 269-385
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-18
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 4 Region: 672-743
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000657
Family PDZ domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000009994
Domain Number - Region: 411-455
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.0157
Family Sec2 N-terminal region 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000009994   Gene: ENSXMAG00000009976   Transcript: ENSXMAT00000010008
Sequence length 1235
Comment pep:novel scaffold:Xipmac4.4.2:JH556893.1:676266:699225:-1 gene:ENSXMAG00000009976 transcript:ENSXMAT00000010008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESSHRTSKGSSLSSEGSWYDSPWGAAGELTDSVFVCGQSVDTSSGYNTCSSTQPDLHDLN
LASPSDFHSRQNALPAFPTSADSFLQQQLLPAMDNVIQEEAPSVGGIEPRYFSHTLPNRK
AEPVSAAFSGNNRKDFLKSRIRQLSDWTGSLSRKKRRIQEPHSSDSSGVFINSLNAGAPW
PSNPLLQLSQNQFLPADWDFSRSLDQNQSSDAQRQNVYRSFMRELETGCGGAADRIEPSE
DDDDAEEEMEEEAGGGDLDGLLEADQGAVRRAGWLYFKSLISVSKDRKLELVARRKWRRY
WVTLKGCSLLFYATFGRSSGAEQDLSPRYALLADDSIVQAVPEHPRREHVFCLSNSHGDV
YMFQATNQTDLENWVTAIHSASATLLARRQGKEDTLRLLRCQSRSLLHKIDMDGKMKKMA
ELQLSIIKDQKNRRAVESQIQQWEQNLEKLNLDLFRLRCYQSSLQGSELPNPKSLLAVAS
RPSKASLGRLGVFSVSSFHALVCSREDGTLRRRCRSVSGGRRRGLPSSLKVLPKPIQDGK
LSDHQISFSEQFRVFLSGKILKENIPECSSRTELYSLVLLHDKCDTALKSYIFEQKTQLH
ELTNFSLTPTEHVHNVTLLVCFLTRHITDFGLQTVTCVSKQSEVLPSAGHVAELQLSEES
PPSAAGVFSLNVCRPNTEQDFGFAVTGHVDGAGKSHVFVSDVDPMGLSARGGLLAGDEVL
AVNGSAVSGLDLDHLQTLFRHQSLRLLLRRDELPDAEEPTIAWPDPADLWLRDRKLIGYS
KNSVSRIPEYKHKFLGRKAKSANNFPQCNLGLRRQTCGTLNILQHLVFMEENFSFQNTDR
VFSLYQTFPESKTSDIDVPRNPYVREGSLHPPSPAHLSVCQRLRKVIQELVDTEKSYVKD
LVCLFEIYLTPLQNETFLSKDEMEALFGSLPEMLDFQRVFLQTLEERIASCPDFSSLETP
EQFKMLLFSLGGSFLYYADHFKLYSGFCANHIKVQKVLERAKTDATFKHFLETRNPTNQH
SSSLESYLIKPVQRVLKYPLLLRELVSLTDAESPEHTHLTEALRAMEKVASHINEMQKIY
EDYGCVFDQLVAEQSGADKQVTEISMGEFLVHSPVVWLNPLPCLRRLRKEPQLTLFVFKR
AVILVHRENKLKKRMLQTSSRSADLDPFRFRWLIPVSTLQVRPANIPGSEDPCVWELVHS
RSEVEGRPETVFQLCSSDLDAKAALLRALSSLLKD
Download sequence
Identical sequences M4A6A0
ENSXMAP00000009994 ENSXMAP00000009994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]