SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000010095 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000010095
Domain Number 1 Region: 831-1067
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.37e-57
Family DBL homology domain (DH-domain) 0.0000255
Further Details:      
 
Domain Number 2 Region: 1065-1194
Classification Level Classification E-value
Superfamily PH domain-like 2.69e-36
Family Pleckstrin-homology domain (PH domain) 0.00074
Further Details:      
 
Domain Number 3 Region: 648-704
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000164
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0055
Further Details:      
 
Domain Number 4 Region: 161-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000723
Family Ankyrin repeat 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000010095   Gene: ENSXMAG00000010048   Transcript: ENSXMAT00000010109
Sequence length 1546
Comment pep:novel scaffold:Xipmac4.4.2:JH556687.1:1988:50060:1 gene:ENSXMAG00000010048 transcript:ENSXMAT00000010109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSRRKVPLYGEAKVFALLEGLETVPEHAEVYVVLEGSTLVHVTRAQNDVMLYFIVPGH
NLPEEVSVQAYLCSESMQLTWLGGASLEYVQDDAQDLAEHIIIHGHCLNVTDHKELSSLF
SLRQESSRWAMDRKVALAMANLDIPPNWNVLGSHHGDERIPRECPLHLAVRWGFYRLAEL
LLCQPGGLMAVSLPNEEGVTPLQLAQTTGNTELLELLTNFSCSWSCEFISVQLNEERSFE
YGNDFVMTHSTKNTTASQYLEADKLIFYPFLFEYRVYLVFTPKEENQPEETFRTVKPVSR
SEVYISDVVSHFKQSKSLLDPEDLRNIKSTQLYHMVRLEQHAQGREKSQSIRESQASSPT
RAAAARLSAMIHGKDQVYANAMLVDQVDGADIKYRSPGDEEEVSPSSCWDSFSPTLVESG
NCSQNRSQSSPHRRPRGSQGPGWDNGREAYSCVSPPYPFASSLSLPFLRYSDKKVKSRVM
VNSPSLECDSEEEDVLGHSYPCSSSKQRSVLQSSSGEERDSFDTSPDFNRSHSETAKKSN
KVHNSEDAEVRLRSYSYSSSSPKVRQSRPLLNRDSAINDLEEEQRAFNLTETTREKRIED
EEWDKYIIPSKVESEKYKVSRTFSFLKSRMSSTRSKTKVKGKETKEGKEKLGASNGHQFV
PMSPSAPTLCVACDKPVSGKESLQCANCSLNVHKTCRESVAACGKVFHQKYNNLKPEKSF
AKDSSPASLFSSSACSSPSSSVPTMTKEKRETVASFSKSQSISIDSRGWSETAGVDSECN
MTACTNSSPPEEGIPVTTTPHFTDLPISTKDTVDAPLLSDLSADLLGLEAESWSLAVSPV
FCSQHDRRTIKRQDVIYELMQTELHHIQTLTVMSEVFRRGMLEELQLDSDCVARIFPCLD
PLLLFHRNLFRALQECRQAATQTDNSRNYLIHRIGDVLLQQFSDENAETMKQVYGEFCSH
HMEAVNVFKELQQQNKKFQNFVRQQSNNSLVRRREVPEFILLVTQRVTKYPVLLEKILQY
TQDGSQEHSNLSDALAQIRDIITAVDVMVGKYERSQELQEVLARLETKSFAKLKNGKVFR
KQDLHTKHRALQHKGLLYWKTATGRLKDTLALLLTDVLVFLQEKDQRFIFASVDQKPPVI
PLQKLIVREVANEERGMFLISASSVGPEMYEVHTTTKEERNAWMRHIRQAVESCPEEEEE
EERTAETEEARQAAEVRVQKISKFQETLLGQDQQICHNLEEKLQLYADITELTLRSPESV
PHRHLLVGPAQYFDIEAPRQASSLLTAALREVNYFLINLFILKKEKKSINLSSNTPMIDT
TLCSSGRAHALFIAEQSSIFTKTRDGVPVHSQNSPLQAPECCSYNSHGSSIQESPSERES
QVAESVQSLTQLLYSLQAAVTLQDSFYEVQKLLLQEQEKQRSTDKMKEEKKSLERKKEDV
DEVQKLQVKLKQEQQRWEKECVAREKQQTDQENVLEQREQQCLSESERLRCEREELDAQL
QEYQQNLDRLREGQRSVEREKERIETQQRLLQSWRHSRQSSLPVTI
Download sequence
Identical sequences M4A6K1
ENSXMAP00000010095 ENSXMAP00000010095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]