SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000010181 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000010181
Domain Number 1 Region: 192-390
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-51
Family DBL homology domain (DH-domain) 0.00000971
Further Details:      
 
Domain Number 2 Region: 389-512
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-32
Family Pleckstrin-homology domain (PH domain) 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000010181   Gene: ENSXMAG00000010164   Transcript: ENSXMAT00000010195
Sequence length 672
Comment pep:novel scaffold:Xipmac4.4.2:JH557529.1:23728:55844:-1 gene:ENSXMAG00000010164 transcript:ENSXMAT00000010195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHTGTTTIVELSFLLSSVKHNSYSAAGSEGSISTSVASLPPQPSGSSAPSSPSSRRSVS
ALTKWLTNPVRKLSTGSTVKGDRQVRKLEGKTPPLSSQSQNQSQDLFSPVRPDEAFTILP
VTHREQEWKDGLASPEDLSPESLQPSGFMTALPVDFTALPNTQDTQSAGLPPKDSDSVLM
DDTSSQWSAVAETEEERRSAFEKSMYVLNELIETEKDYVADLGLIVEGYMATMSSRGVPE
GMKGKDKIVFGNIHQIYDWHKDYFLEELEKCLEEPENLAQLFSKHERRLHMYVVYCQNKP
KSEHIVSEYIETYFEELRQQLGHRLQLNDLLIKPVQRIMKYQLLLKDLLTYCVKAGKDTK
ELEKAVEVMCLVPKRCDDMMNVGRLQGFEGNITAQGKLLQQGTFTVTEQDSGFLSRAKER
RVFLFEQLVIFSEPIDKKKDFSIPGYIFKSSIKVSCLGMEPSVDGDDTRFALTSRNPDGS
VVRYQLQGSSAEICRAWVNDVGQILESQRNFLNALQSPIEYQRRESKSNSLGRSMRPPLS
ATSALRPHSSASIDRHKLPSLHSHNTSLPTLYLPSQSQSQGPSEMVSLRSATPVPAVSHT
ASPSHVRLGLSDQSNCPAVSNGLYTPATQGAQRAVEGFYRGSASDVVPQASLSGPSAGRR
PSNLAQLAEDDL
Download sequence
Identical sequences M4A6T7
ENSXMAP00000010181 ENSXMAP00000010181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]