SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000010194 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000010194
Domain Number 1 Region: 11-234
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-55
Family DBL homology domain (DH-domain) 0.0000274
Further Details:      
 
Domain Number 2 Region: 220-361
Classification Level Classification E-value
Superfamily PH domain-like 8.31e-35
Family Pleckstrin-homology domain (PH domain) 0.00054
Further Details:      
 
Domain Number 3 Region: 475-605
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.96e-28
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 384-489
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.86e-27
Family DEP domain 0.0047
Further Details:      
 
Domain Number 5 Region: 675-741
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000104
Family PDZ domain 0.017
Further Details:      
 
Domain Number 6 Region: 576-671
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000802
Family PDZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000010194   Gene: ENSXMAG00000010123   Transcript: ENSXMAT00000010208
Sequence length 1578
Comment pep:novel scaffold:Xipmac4.4.2:JH556681.1:2184067:2278609:1 gene:ENSXMAG00000010123 transcript:ENSXMAT00000010208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEESRSEHRAESGKDQEKQLRLRVCVLNELLKTERDYVGTLDFLSVFLHRLNQYAATKI
DKNITEETVKVLFSNIEEILAIHKDFLSMVEELLQPDPHAHHEVGRCFLHFKSRFQIYDE
YCGNHEKAQRLLLELNKIRSVRTCLLNCMLLGGRKNTEVPLEGYLVAPIQRICKYPLLLK
ELLKRTPRKHNDHALVQESLQVMKAVCSSINEAKRQMEKLEILEEWQSHIEGWEGSNITD
TCTEMLMQGVLLKISAGNIQERVFFLFDKLLVYCKRKNRRLKNSKASSEGPRYQFRGRIN
TEVMEVENVDDGTADYHSSGNIVNNGWKIHNTAKNKWFVCMAKTPEEKQEWLEAIMKERE
RRKSLRLGMEQDTWVMVSEKGEKLYHLMTRGNLIKDRKRKLTTFPKCFLGSEFVSWLMEI
GETGNPEEGVHLGQALLENGIIHHVTDKHQFKPEPVLYRFRYDDGTYHPRSDMHDVIAKG
VRLFCRLHSLFNPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEALILGVELCDN
GFMHHVLEKSEFKDEPLLFRFFADEEMEGSNTKHKPLKHDLKIVENVIAKSLLIRPSDGS
YGFTLEERNRVPIIKCVEKGSAAEMAGLEVGKKLFAINGDLVFLRPYSEVEVLVRQCFNS
KGPLRVLVSTKPRETIKIPDSADGLGFQIRGFGPSVVHAVGRGTVAATAGLHPGQCIIKV
NGINVSKESHASVIAHVTACRKYRRPSQQDTIKWIYNNSESALEENQKSNQKPTLDENGD
GFEGKVEEVMDKFNTIAIIDGKKDHVSLTIDNVHLEYGVVYEYDSTAGIKCHVLEKMVEP
KGFFSLTAKILEALARNDDMLLQMCSRLSSSCDVIPDDLQVRFSAMCSERAEHINRRVTN
YRKFSRVLKNRAWPTFKQAKAKVSPLHSSDFCPTNCHINVMEVSYPKTTTSLGSAFGVQL
DSRKNSLEKSARSAGESGKLNPMVNAQYTITTMAAPSSHSLGRTEGHGLRFLLREDDLLT
LDAYQKLLYKLTAAVKEMETHGAHIHDLLSSITYPAASEVRHPESYISAESEGEKAERNG
KKVCFNVTGDEQEDSGHDTISNRDSYSDCNSNRNSIASFSSICSSHCSSYVHSDDMDSGD
EMPSSVWLSHDKQKKLHSFLEHLFSQVDSITSMLRGAGVARVFEQTKCFTPARGLQEFLQ
EMEPRVNCAKKLRLHIKQDPWNLPNSVQGLTQIISKYVEEVKTRLLLVLLQYTDSEIQLR
RDMVFCQSLVAVVCAFSEHLLAVLNQFHNVGVELDQDFPDPQELQEAQEASRRWLEQIAS
AGLLFHFQSLLSPNLTDEQAMLEDTQVALIDLEKVTFYFQQFEGEPMVANMPISYQVEGT
RQALKVCFYLESYYFAHLPYRLKNGGGVKIYPVLFTQALESMEGYYYRDNVSVEEYQAQI
NSSSLEKVKQYNKRLGAFFLDQSNIPPSTAPKAALIDKLMRPLNALEELYRLMESFISCR
RTAACQFTACGASGVGLLTVASELCSRLGATHVVMCNSGVHRCTLSVTLEQAILLARNHG
LPPRCIMQATDVMRKQVR
Download sequence
Identical sequences M4A6V0
ENSXMAP00000010194 ENSXMAP00000010194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]