SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000010410 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000010410
Domain Number 1 Region: 892-1189
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.77e-95
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000872
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 5.76e-27
Family Second domain of FERM 0.00045
Further Details:      
 
Domain Number 3 Region: 215-355
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-25
Family Third domain of FERM 0.0029
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.99e-18
Family First domain of FERM 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000010410   Gene: ENSXMAG00000010368   Transcript: ENSXMAT00000010424
Sequence length 1193
Comment pep:novel scaffold:Xipmac4.4.2:JH558110.1:21638:36098:-1 gene:ENSXMAG00000010368 transcript:ENSXMAT00000010424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGFKLKRTRRYTVSSKSCLVTRIQLLNGEFVEFTLSVESTGQECLEAVAQRLELRE
ITYFSLWYFNKQNQQRWIDLEKALKKQLDKYGQEPTVYFGVLFYIPSVAQLQQEITRYQY
YLQLKKDVLEGRITCSLDQVIRLASLAVQADFGDFNRYDSQEFLKKFALFPIDWIQDERV
LEEATQKVAILYQSFRGFPAPEAEMLYMQEVEKLEGYGQESYQAKDNTGIDVTLGSCLDG
IFVKYKNGRSPLLYRWHEITNMSHNRSFFGLELSNREESVQFQTDDMETSKYVCRMCLAR
LKFYKTNKSNFQTPPTAVNLVRRRSSTRISLPKSQAYLMPQMHYNGHFTEPYTSSQDNLY
VNPQNGFYYHSQTSLDRSPLEYSSGGRLRNGSVYSAHSTSSLNNPQHYHQPSPMSSNPSI
TSDITRPDFIPSHRHSALIPPSYRATPDYETVMRQKNRGMAGGMVLSQEHRQSHSMRNLN
IGNSYAYSRPDPLVYSQPEIRVEYGGTSHHHQYPFHLGSSFHSPSPYPYPPERRPVVGAV
SVPELTNVQLQQAQEYPAPNIMRTQVYRPPPPYPYAYPRPANSTPDLSRHLYVSSSNPDL
IITRRVHHSVQTFQEDSLPVAHSLQEVSEPLFSAPPHRQPYHAHKRNSIEIAGLAHSLEA
VRVKERTMSSSAAEAATPPPVVHSGSQVNVFLEHTKTAERGDAQYGHKKSLSDATMLVHS
SGEDEELEDDIGRHTPLSQEAVVIPEQPPPPQHRSLTSLSSVTTQQQIPKEPPPAYPIGS
ALDPSKTSSLVYKVHPRIHKGEPLYLLSDLRQPEIMPSVSESDVSEQDNRKPKRDFSKGL
VFSLPAGGETLQGLPPPGMKKGSRSEVRKMGPLKLARHNGLSVSRKVVQNEVVDEPEQPS
NDEKCKLLEQHVEMGELLKEFESVPKRVPGEDCNTALLPENRDKNRFVDVLPYDSSRVEL
VPTKENNTGYINASHVKVTIGGQTWSYIAAQGPLSHTCADFWQMVWEEDVSIIAMVTAEE
ESGREKSCRYWPRLGSRHNTVTYGRFRITTRFRTESGCYATTGLKIKNVPKDQERTVWHL
QYTDWPDHGCPEDFKGFLTYLEEVQSVRRHTNAISDPKNINPVLVHCSAGVGRSGVVILS
ELMIACLEHNEMLTVPEVLRLLRDQRMLMVQTLSQYTFVYKVLIEYLRNSRLI
Download sequence
Identical sequences M4A7G6
ENSXMAP00000010410 ENSXMAP00000010410 XP_005815750.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]