SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000010903 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000010903
Domain Number 1 Region: 151-294
Classification Level Classification E-value
Superfamily PH domain-like 7.62e-41
Family Third domain of FERM 0.00027
Further Details:      
 
Domain Number 2 Region: 459-671
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.03e-39
Family DBL homology domain (DH-domain) 0.00057
Further Details:      
 
Domain Number 3 Region: 799-948
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-31
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 4 Region: 655-778
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-27
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 5 Region: 51-153
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-26
Family Second domain of FERM 0.00018
Further Details:      
 
Domain Number 6 Region: 1-50
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000413
Family First domain of FERM 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000010903   Gene: ENSXMAG00000010868   Transcript: ENSXMAT00000010917
Sequence length 965
Comment pep:novel scaffold:Xipmac4.4.2:AGAJ01041847.1:10132:36221:1 gene:ENSXMAG00000010868 transcript:ENSXMAT00000010917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLIEGDYFGLEFQNHKSMMVWLDHIKPIIKQLRRPKNTTLRFSVKFFPPDHAQLLEELT
RYLFALQVKQDLSSGRMMCNDTSAALMVSHIIQSEIGDFDESHCRSHLLNNNYIPDQMPL
IDKIMEFHSKHIGQSPAESDFQLLEVARKLDFYGTRLHPAKDREGSKLSLAVAHTGVLVF
QTHTRINAFNWSKIRKLSFKRKRFLIKLRPDLNSSCQDTLEFLMASRDCCKVFWKICVEY
HAFFRLFEEPKPKPKPMLFTRGSSFRFSGRTQKQVIDYVRESEFKKIPFERKHSRIRYSS
RVQHNSRLSPLPSPRHHEVPSESGVPEDFSSSSPPRRHWKESVLVSAEDPAASRTSKMSP
NHQRNGHEDRKESVSKPEESRGSTRQMSPEHPSKGVAPHSPPPSGHPHGMVNGQKSLELC
SNSLDGRQPSPLTSPLLNDACSIRTDDEDEVRRKRFPTDRAYFIAKELLTTERTYLKDLE
VVTVSFQSVVEQDEATPDSLKNTILSTFEPLHKFHTGFLREVEQRLAMWEGRSNAHIKGD
YQRIGDVMLNNLQALKPLTTNMHKHSDILLELEKACKASRRMENLCRDFELQKVCYIPLN
VFVLRPLHRLIHYKQILERLCKHYPATHEDFRDCRAALADVSEVVDQLQGSLLKMENLQK
LLELQKDLLGVDNLVVSGREFIRLGCLSKLSGKGLQQRMFFLFNDVILYTSRGMTPTNQF
KVHGQLPLRDMTIRESEEEWGVPHAFTLVGQGQSVVVAASSLTEMEKWMQDIKMAIEVAK
TSNGPTSDALTCTLTDNKCPEDSTAEAESEDDTTALHTSLEKPTPHRGNTMVHVCWHRNT
SVSMVDFSVAVENQLSGNLLRKFKNSNGWQKLWVVFTNFSLFFYKSHQDDYPLASLPLLG
YSVTVPTENENIHKDYVFKLHFKSHVYYFRSESEYTFERWMEVIRSATVSSSQARLLNSK
YPHPH
Download sequence
Identical sequences M4A8V9
ENSXMAP00000010903 ENSXMAP00000010903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]