SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000010992 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000010992
Domain Number 1 Region: 484-772
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-79
Family Protein kinases, catalytic subunit 0.000000000337
Further Details:      
 
Domain Number 2 Region: 1007-1147
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 2.62e-58
Family FAT domain of focal adhesion kinase 0.00000025
Further Details:      
 
Domain Number 3 Region: 186-306
Classification Level Classification E-value
Superfamily Second domain of FERM 2.99e-39
Family Second domain of FERM 0.00000205
Further Details:      
 
Domain Number 4 Region: 84-183
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.99e-38
Family First domain of FERM 0.0000132
Further Details:      
 
Domain Number 5 Region: 307-415
Classification Level Classification E-value
Superfamily PH domain-like 6.39e-35
Family Third domain of FERM 0.00000415
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000010992   Gene: ENSXMAG00000010911   Transcript: ENSXMAT00000011006
Sequence length 1151
Comment pep:novel scaffold:Xipmac4.4.2:JH556687.1:2888239:2943475:-1 gene:ENSXMAG00000010911 transcript:ENSXMAT00000011006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENSGCIPLCWSKGACIYAQHPLPKYDGQLAPAGPSQSGMASSSYLEPSLNHSTPGGCGV
KSRPGMPGAPGTSGSAGGLERPPGSMDRVLKIFHYFETNSEPSTWASNIRYGDATDVRGV
IQKIAEIHKLRCVSSLGLRLTHLHSDVLHWLHPDLGVSHVRERFEKQHPQEEWRYELRIR
YFPKGYLSHFSEDKPSLNYLYHQVKSDYMQHLADQVDQDVALKLGCLEIRRFFREMPGNA
LDKKSNYELLEKDVGLRRFFPKSLLDSLKAKTLRKQIQQTFKQFANLNDEQSIHKFFEII
TPIYPFDKECFKCALGSSWVISVELAIGPEEGISYLTDKGSTPTHLANFNQVQSIQYSAL
EEKDRKGMLQLNVAGAPEPLTVTTALLNTAENMADLIDGYCRLVSSVTRSFIVRVHKEGD
RALPSIPKVSNHEKRMEKRMDGVRTRAVCVSGHISGDETDDYAEIIDEEDTYTMPSKYYG
LDQARDYEIQRDCIELGRCIGEGQFGDVHQGVYISQENPALSVAVKTCKNSTSDSVREKF
LQEALTMRQFDHPHIVKLMGVITENPVWIIMELCTLGELRSFLQVRKYSLDLATLILYSY
QLSTALAYLESKRFVHRDIAARNVLVSTVDCVKLGDFGLSRYMEDSSYYKASKGKLPIKW
MAPESINFRRFTTASDVWMFGVCMWEILMYGIKPFQGVKNNDVIGRIENGERLAMPPQCP
PTLYSLMTKCWSYDPSKRPRFNELKIQLSTILEEEKLQQKERNRMEMRRQVTVSWDSGGP
DEAPPKVWSRESYCERLWKPSRPGYPSPRSSEGFYPSPQHPVHYQMAAYPGPHTLPSVPS
ALYPPQATMVDTHHAHTHPRHHVHTHSHAQLLPQPHGTDMALWGSAMEDRAVDMQQCVGQ
QCLLMEEQLMIQQQQMEEDQRWLEQEERLLKPDTRSSRGSLDREDSGLQPPTGNQHIYQP
VGKSDHVVPPKKPPRPGAQSQVGSLACLNTGDSYNDGVKPWRLQPQEISPPPTANLDRSN
DKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKDVGLALRTLLATVDETLPQLPASTHR
EIEMAQKLLNSDLAELIGKMKLAQQYVMTSLQQDYKKQMLTAAHALAVDAKNLLDVIDQS
RLRMMAHSRPH
Download sequence
Identical sequences M4A948
ENSXMAP00000010992 ENSXMAP00000010992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]