SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000011049 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000011049
Domain Number 1 Region: 209-327
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-36
Family Third domain of FERM 0.00048
Further Details:      
 
Domain Number 2 Region: 108-208
Classification Level Classification E-value
Superfamily Second domain of FERM 4.06e-28
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 28-108
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.99e-23
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000011049   Gene: ENSXMAG00000011030   Transcript: ENSXMAT00000011064
Sequence length 349
Comment pep:novel scaffold:Xipmac4.4.2:JH556921.1:623694:632587:1 gene:ENSXMAG00000011030 transcript:ENSXMAT00000011064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDRHRRTRTLGGLATKPRVSKETKLRLRVIFLDDSERTFEVEQNVLGGDFFNKVCGHLK
LLEKEYFGLEFRHHSGHYVWLELLKPLVKQIKYTNDLFFRFIVKFFPPDPGQLKRGLTRY
LFALQIKQDLSNGSLTCNDNSAALLVSHILQSEIGDYDEELDYQHLEMKHYVPNQEYLDN
KIIKLHKRHRGVSPADSDIQLLEVARKLDMYGIRPHAANDGEGMRINLAVTHSGVLVFQG
NTKINTFSWAKIRKLSFKRKHFLIKLHDKVGASCKDTLEFAMASRDVCKLFWKMCVEYHA
FFKLAEEPKPIHKTLLSCKGSRFRYRYTNLSHAIMDPGNPKCLNRTQLD
Download sequence
Identical sequences M4A9A5
ENSXMAP00000011049 ENSXMAP00000011049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]