SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000011090 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000011090
Domain Number 1 Region: 955-1132
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.63e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 526-642
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.98e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.0012
Further Details:      
 
Domain Number 3 Region: 688-837
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-21
Family Pleckstrin-homology domain (PH domain) 0.0033
Further Details:      
 
Domain Number 4 Region: 145-201,322-416
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-21
Family Pleckstrin-homology domain (PH domain) 0.00039
Further Details:      
 
Domain Number 5 Region: 8-72
Classification Level Classification E-value
Superfamily SAM/Pointed domain 9.82e-17
Family SAM (sterile alpha motif) domain 0.0028
Further Details:      
 
Domain Number 6 Region: 434-542
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000462
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number 7 Region: 858-981
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000258
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 8 Region: 1268-1387
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000782
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000011090
Domain Number - Region: 1179-1256
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00121
Family Ras-binding domain, RBD 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000011090   Gene: ENSXMAG00000011055   Transcript: ENSXMAT00000011104
Sequence length 1447
Comment pep:novel scaffold:Xipmac4.4.2:JH556753.1:1285932:1338409:-1 gene:ENSXMAG00000011055 transcript:ENSXMAT00000011104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMSLTESSANVSDWLSTLRLEQYGEAFQEAGLTTLQDCQNLTPNQLDRMGINLPGHQKRI
LANINKMTARIRPTPRERDKPVPKERHLSNIQDNSNREGETKPFPLQRHSAPVGGKEEER
SRAPDEKRAKPVPKERTKFRSNSCQPTPIVSPLPDTSLPPVPPRSTPNCPPQPFISSLSS
SSPAQHSISLSLDRIVVVPPEPPLPPTRICLPQTPPFILRLCPTQEISKPSDQTELQPAL
PARKISKPPREQEPTSLLVISCMSCGTQYSDDELLDEDENPHQYGGLYSPPWQTERIVNL
PGSFCLPNSGRLSTPIKEDSSQLSSVIKMGWLDKNPPQGALYYQRRWVKLEFDYLRYFDN
EKEVYSKGFISTAFITNVSSVGELKFEVATNNRTFIFRAENEDERNEWVTELRNCTGGPK
RPITLIAGSPLTPDYFGYLELRGLRSKLFTVVASDKVLLYKSADDYRIGVGITFIDMNVG
NVKDSDRRSFDLTTPYRIFSFIAESEQSREQWVQAMRNAIGEALSNSEVVEQIWREPSNS
FCADCGAPQPDWAAINLCVVICKQCAGEHRGLGPSISKVRSLKMDKKIWTEELIQVFLKL
GNERVNSFWAANVPPSEALSPSSCSEDRRRFISNKYRQGKYRKYHALYGNQRELNNALCI
NVQCSDLLETLSLIFCGADVNCSTGMANCPSPESLASAHSQPLQAELIKHNLNTELPQLQ
VEADMDLKHYPPPPCVSYEGYLFKTASMGRAVAERKVKEEFSRRWCMLNDGIFSYYEHDK
STNPNGTLKASEIVCLAVDSPEKHGYDFTFEVYSESERIYLFGTDEPDSHKEWVKCIAKT
FIPATAEPLLRLSFERIGRLKCKDGLNLQKSKVGWFALTGSTLHVYLENSKGEEIHLRKL
NELSIQQDNEVLVLVEKGRTLYIEGERKLDFAGWCGAIQAAAGSGGDTLSQQQLTDTDIP
VIVLSCIDYITQCGMTSEGIYRKSGVNSRVAALCDRFRRDARSLRLKEGEHQVDDVSNTL
KRFFRELEEGLFTSEYAYSWLAITALQDENTKISEYKALLDRLPRVNKATLQALINHLYC
VQRFSDLNQMNLHNLAIVFGPTLFQTDGKDYTAGRAVEDLIEHYTVIFEVDEQQLKRQLE
EIKAIIRMRDNLNTKFPSRPRFEGDGHFICTVYLEERKDTAEQHVKIPGSMTAAELAYEV
LDRRNIPVKDKDYWSCWEVCEEIERPLHYQERVLPILHSAGNESHLLIKKQPAMDAMITY
LATKVDISKHGMMKFREERSILGLGLSSGNFHDRFFILNVTSLRMYKDVRTHDLFCVFCQ
SNRAEREWIIKNLKIYLGIKKKLRPPTCWGLTVVYESKKQEKPERQQWYLCCETQSEMRE
WYATFLSIQNDGNLWPQDGVQQNPVSRVLPDTRHGNVSLIPLRGSENEMRNSVAAFSQDA
LALLRDV
Download sequence
Identical sequences M4A9E6
ENSXMAP00000011090 ENSXMAP00000011090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]