SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000011177 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000011177
Domain Number 1 Region: 1691-2056
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.83e-91
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000591
Further Details:      
 
Domain Number 2 Region: 963-1054
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000368
Family Ubiquitin-related 0.011
Further Details:      
 
Domain Number 3 Region: 3-45
Classification Level Classification E-value
Superfamily UBA-like 0.00000488
Family UBA domain 0.021
Further Details:      
 
Domain Number 4 Region: 302-597
Classification Level Classification E-value
Superfamily ARM repeat 0.0000487
Family Diap1 N-terninal region-like 0.094
Further Details:      
 
Domain Number 5 Region: 2205-2538
Classification Level Classification E-value
Superfamily ARM repeat 0.0000832
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.093
Further Details:      
 
Weak hits

Sequence:  ENSXMAP00000011177
Domain Number - Region: 1408-1484
Classification Level Classification E-value
Superfamily ARM repeat 0.0107
Family Clathrin adaptor core protein 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000011177   Gene: ENSXMAG00000011121   Transcript: ENSXMAT00000011191
Sequence length 2621
Comment pep:novel scaffold:Xipmac4.4.2:JH556665.1:231025:271539:-1 gene:ENSXMAG00000011121 transcript:ENSXMAT00000011191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METEEEQHITTLLCMGFPDPDVIRKALRLAKNDINEAVALLTNESPGLGYGYEPMESGPS
TGLGSSGDGENSGRTGTSGFDPPPAYHDVVDGERSNDENGNCSGGSMEFPTTNLYELESR
VFTDHWSIPYKREESLGKCLIASTCLARHGLADADENCKRFVERCMPEAFKKLLTSSAVH
KWGTEIHEGIYNMLMLLVELVAERVKQDPVPVNLMGVLTMALNPDNEYHFKNRMKSCQRN
WAEVFGDEANIFGVSPSNTYQKEPHGWLVDLVNRFGELGGFAAIQTKLSSEEIEIACVSA
LVQPLGVCAEYLNSSLVQPMLDPVIHKTITYVQNLEEKDLKDKRLVSIPDLLSAIKLLCM
RFQRELVAVVDDLRLDTLLRMLKTPHFSTKMNSLKEVTKLIEESTVSKTVKNAIDTDKLL
DWLVENSVLSIALEGNIDQAQYCERIKGIIELLGSKLSLDELTKIWRIQAGQSSTVIENI
HTIIAAAAVKFSFDQLTHLFVLIQKSWEVESDRVRQKLLSLIGRIGREARSETTTGKVLE
VLWELAHLPTLPTSLVQQALEEHLGILSDAYAVKETVKRSYIIKCIEDIKKHHTQEDDKG
SITQSSFHIGTWHKKKSNSLAKASQQSTPQTVWVVPALRQLHEITRSFIKQTYQKQDKSI
IQDLKKNFEIVKLITGSLVCCHRLAVSASGNNGLSASTLVDGRYTYQEYLDSHLRFLAFF
LQEASLYLVWNRAKELWECLVSGPDVCELDRELCFEWFTKGQHDLESDVQQQLFKEKILK
LEPYEITMNGFGLFKTFFENVNLCDHRLKRQGTQLCVERLDLAGMDFIWRIAMETPDEEI
ANEAIQLIITYSYTNLNPKMKKDSVSLHKKFIADCYKRLEAASSALGGPTLTHAVTKATK
MLTATAMPTVATSVQSPSRSTKLVIIERLLLLAERYVITIEDLYSFPRTILPHGASFNGH
PVTLHITYESTKDTFTLETHSNETIGSIRWKISEHLSCPVDNVQIFANDSVLTMNRDQKL
LSQLGFSDEQSLTVKSSGTGTPSGSSESSASASSSSSSAVFNSAYALEQEKSLPGVVMAL
VCNVFEMLYQLANLDEPRIILRVRKLLLLIPTDPEVQDALDNFVPKESSVWSHQKTLFTL
GQGSGSRSPSVTPKQQHQPSAASILESLFRSSAPGMSTFRVLYNLEVLSSKLMPTSDDEM
AKTSSKSFCENFLKAGGLSLVVNVMQRDSIPSEVDYETRQGVNSICLQLARFLLVGQSMP
MALDDDVIRDGDALSSRPFRNAGRSGRQLSLCGTPEKSSYRQMSLSERSSIRVEEIIPAA
RVAIQTMEVGDFTSTVACFMRLTWAAAAGRLDLVGSQQPIRETHSALLPQGVRTRVSSTG
SNCSSSSEGEATPTALHAGICVRQQSVSIKDAIIAREALSLLVTCLQLRCQQMSSFYTLP
SVSDFIIDILLGSPSAEIRRVACDQLYTLSQSDTSAFPEVQKPNLFLLSVILTAQLPLWS
PTSVMRGVNQRLLSQCTEYFDLRCQLLDDLTSSEMEVLKVSAANMLEDEISWLDNFEPSW
SSEMETSEADNILLAGHLRLIKTLLSLCGNEKEHLGPSLIQQLLDDFLFRASRIIINSSN
PTPSPAPSHDFHPKCSTASSRLAAYEVLVMLADSSLSNLRLITRELLSMHHQSDPSLCKE
FDHLPPVESRSVSGFVGLKNGGATCYMNAVFQQLYMQPGLPEAFLSIEDDTDQPEESVFY
QVQSLFGHLMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEFFTSLVDQLDEHLKKMG
REQIFKNTFQGIYSDQKICKDCPHRYEREETFMALNLGVTSCQSLEISLDQFVRGEVLEG
SNAYYCEKCKEKRTTVKRTCIKSLPSVLCIHLMRFGFDWESGRSIKYDEQIRFPWVLNME
PYTVSGMARQDCSGDGAEGRGDGSSGGSPRKKVTISENYELVGVVVHSGQAHAGHYYSFI
KDRRGNARGRWYKFNDNVVEEFDMNDETLEYECFGGEYRPKVYDQSNPYPDVRRRYWNAY
MLFYQKISDQNSPALPKKSRVSIMRQEAEDLSLSAPSSPDVSPQSSPRPLRANNDRLTLL
TRLVRKGEKKGLFVEKMPASIFQMVRDENLRFMRNRDVYNSDYFSFILSLASVNATKLKH
QNYQPMAKESLQLAVHFLFHTYLHTKKKLRVDTEEWMAAVEVLLSKSSEACQWMVQFLVG
SEGREIIRVCLLECSVREVRTVVASVLEKALESALHFGDPGLDSLTDALLSLLDKDVPEN
VKNCAQYFNLFSNFTQRGCGPCQLLLKHSAYRRMLIFLLGPNRQNNQNRRWSPAQAREFL
HLHSSLALMTLHSDLSPQRTLAPGGSKLPASSVHSSGPLLPLHSDILASLFTPEGQPYLL
EVMFAMRELSGPLSLLIEMVTYCSYCNEGFSLGVLQLLKSQMETAPPHELKNVFQMLQEI
LVVEDPLQSQRLKYAFESDKGLLALMHQSNNVDSRRCYQCVKFLVTLAQKCPPAKDYFKD
LSGHWSWAVQWLQKKMTEHYWTPQSNVSNETSTNKTFQRTISAQDTLAYATALLNEKEQS
GSSNGSDGSPANENAERSLRQGSESPMMLGDSKSDLEDVDS
Download sequence
Identical sequences M4A9N3
ENSXMAP00000011177 ENSXMAP00000011177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]