SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000011303 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000011303
Domain Number 1 Region: 3-302
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.91e-88
Family G proteins 0.000000000525
Further Details:      
 
Domain Number 2 Region: 528-635
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-23
Family Pleckstrin-homology domain (PH domain) 0.00000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000011303   Gene: ENSXMAG00000011231   Transcript: ENSXMAT00000011317
Sequence length 830
Comment pep:novel scaffold:Xipmac4.4.2:JH556665.1:807331:835495:-1 gene:ENSXMAG00000011231 transcript:ENSXMAT00000011317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRGMEDLIPLVNRLQEALSTVGQSCSLHLPQIAVVGGQSAGKSSVLENFVGRDFLPRG
SGIVTRRPLILQLLNSSAEYGEFFHCKGRKFTDFGDIRREIESETRRLTGSNKGISPVPI
TLKIYSPHVLNLTLVDLPGITKVPVGDQPADIEYQIRDIIMQYICKENCLILAVTPANTD
LANSDALKLAKDVDPQGQRTIGVITKLDLMDKGTDAKEILENRLLPLRRGYIGIVNRSQK
DIDGNKDIMAALESERDFFLSHPAYKHIAERMGTPYLQRILNQQLTNHIREALPAFRSHL
QSQLLALNKKAEEYRKFSPDDASRRTKTLLQLVQRLAVDFEKLIEGSGDKVDTVTLSGGA
RINQIFHERFPTELVKIESDERKLRQEINYAIRNIHGVRTGLFTPDMAFEAIVKKQITSL
KGPCIKFIDMVSQELITTVYQCISKLSAFPQLREETERIIITEIREQENKCREQVLLLID
IQLAYINTKHEDFIGFTNSQQVNSQSNMNSSVQIARNQGVVFRSNRIVIQKGWLTISNIG
IMKGGAKEFWFILSTESLSWYKDGEEKEKKYMLPLDNLKLRDVEKGFMSSKFVFAIFNTE
LRNVYKDYKCLELACNSQEELDSWKASLLRAGVYPERDAAEEQESGAQSFTDPQLERQVE
TIRNLVDSYMSIIYKTVRDLMPKTIMHLMINSVKEFISSELLAQLYALGECSALMDESPE
QKQHREEVLRKHSALKEALTVIGEISSSTFTTPLPPPVDSSWIQHQSSTQRKNSATAGRL
VIRGHAPPVPRVNPSGPNSSTDGLQQLTGQHNRVTTSVPRRQPPAIPGVK
Download sequence
Identical sequences M4AA09
ENSXMAP00000011303 ENSXMAP00000011303 XP_014326389.1.87360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]