SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000011419 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000011419
Domain Number 1 Region: 324-512
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.55e-61
Family Regulator of G-protein signaling, RGS 0.00000985
Further Details:      
 
Domain Number 2 Region: 728-956
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-59
Family DBL homology domain (DH-domain) 0.0000000316
Further Details:      
 
Domain Number 3 Region: 959-1093
Classification Level Classification E-value
Superfamily PH domain-like 3.61e-37
Family Pleckstrin-homology domain (PH domain) 0.00000957
Further Details:      
 
Domain Number 4 Region: 22-103
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-18
Family PDZ domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000011419   Gene: ENSXMAG00000011381   Transcript: ENSXMAT00000011433
Sequence length 1096
Comment pep:novel scaffold:Xipmac4.4.2:JH556916.1:426715:471859:1 gene:ENSXMAG00000011381 transcript:ENSXMAT00000011433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTQSMGNPLKHEFDPTEMAGLVQRCVIIQRDKNGFGLTVSGDNPVFVQLVKEDADGAAMR
AGVQTGDRIIKVNGTLVTRSNHKEVVKLIKSGSYVALTVLGRPPGLSQMPLEEAQEQEEH
EEVSMPLPLSAPNSPALFGAERSSFLSGSPQNHNNCTLSDGVRPQPRVPRDSTQLTYYER
NETEKEKLIKEQTGEEVPPTSSNAVSIVTGNKSEIYSSVETHSTPVPEASGKRESPLQSP
DVCRRDDLNSCSSPDTEDAPDTESKPKCNLHVEFRKCPSNSVNVLDSSPHSSVASPPYTV
NPQIIGAEDDYFDYQQEQINGECSCFQSIDLLKSRPAHLAVFLHHVVSQFEAAPLLCYLY
AEMHKQTSSKESRRFFMEFHSLFLDRTANLKVPVPETIAAELEKRRLELIPEDLCKQYTQ
VLQDSLLSDLLKNLEDFRQKRSMGLTLAEDELSKLDSERGKDQPALEKECACAEHILAKI
EDILPTTQASEEEKCQAMQYVILTYMKHLGVKVKEPRGLEQKRARITFLPKIKRGSKPEK
DGDWKKPRFPNLLVPPRRLSRVDSTLVVKSVELNKQRSPKFSQPAFIIPEPADHPASNPG
RSRANQLSQGSDTSTQYTISVASLGPSSADSTGQETDTSVSPFCIQSRLSDGLQAAEHQD
SLSSPISTQFDFSPSSVDHREDDQDAFRKTFEYYYCNRMEIQPTVGSADFQSEDDQAGEV
ESEEDPLNWQKLVPRGVLASLTSKEIKRQEVINELFITERAHLRKLRVLDGVFCQRLSRH
GILPPDDIKHIFTNLEEIIQLHVSITEQMTAIRKRSETSVIGQIGDDLLAWFSNEEEEKI
KRAIGMFCSNQPSALELIKTRQKKDQRFNLFMQEAESNRLCRRLQLKDIIPVEMQRMTKY
PLLLDNIAKYSEDGEEREKVKKAGECCKKILNHVNQAVKEAENKQQRLVEYQRRLDVSSL
KQSENPMILELRNLDLTKREMVYEGPLSWKVNKDKTIELYTLLLEDIMVLLQKQDERLVL
KFHGKNLTSIPDAKHSFSPVIKLSTVLVRPVATDNKAFFVLSMSENGVQMYELMAQKVSD
RRTWQCLITQCADAMK
Download sequence
Identical sequences M4AAC5
ENSXMAP00000011419 ENSXMAP00000011419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]