SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000011432 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000011432
Domain Number 1 Region: 2-145
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.32e-28
Family DBL homology domain (DH-domain) 0.0012
Further Details:      
 
Domain Number 2 Region: 147-236
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000193
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000011432   Gene: ENSXMAG00000011412   Transcript: ENSXMAT00000011446
Sequence length 238
Comment pep:novel scaffold:Xipmac4.4.2:JH556690.1:1541903:1546750:-1 gene:ENSXMAG00000011412 transcript:ENSXMAT00000011446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQEVRRTGKPFDPMRLEAGCLQFHERFLAYHHYCWEEENNLEFTRKQMESNPHFLAFVQ
WVEKHPQGERMRLGDMQAKPHQRITKYPLLLKAVLKETQEPHVQRALRAMLTSVNSFLES
INDFMQYKDEQLALYISAQRIEGYEVEGINEEIDKIVRDVCHFDLTCPIRGVGSKVVRKL
LLEDNLKIRGYKVLQTEVVALLFSDVLLLTKVQKKAERLKVVRPPLALDRMNCVPLKD
Download sequence
Identical sequences M4AAD8
ENSXMAP00000011432 ENSXMAP00000011432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]