SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000011670 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000011670
Domain Number 1 Region: 55-274
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-51
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 399-460
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000263
Family SH3-domain 0.003
Further Details:      
 
Domain Number 3 Region: 278-392
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000504
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000011670   Gene: ENSXMAG00000011643   Transcript: ENSXMAT00000011684
Sequence length 467
Comment pep:novel scaffold:Xipmac4.4.2:JH556690.1:1842954:1849375:1 gene:ENSXMAG00000011643 transcript:ENSXMAT00000011684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYQQYNEESQNIEILRQSRSDTLIVGEDRSQSERRASSPSLSFSLTQSSLLWRDLPNVCN
NPELEKLTEDQRRLQEVRFEVLTSEASYCRSLDIVVGNFVKNKELEKLLTTQDKNWLFSR
LTEVRAISHRFLAKLEERVESDVLHFTVCDIIAQQCRRFRKVYVPYLTNQSYQDATYQRL
MNDNPHFKRIVDNLEKSHVCQRLPLRSFLVLPFQRITRIKLLVQNIVKRTTPGTVEAENT
IKALKLLERIIQESNDSIAEMKTIESLVSLSGKVEFVDCKTLPLISQKRRLVKEGSITQL
MDSLKQAERTIYLHLFNDYLLVSIQKEGGKFTVIDHCPVEELRTEDFRVKILTLQKNSFR
LHLSQNSLLLRTETKSDKLRWISALSRSCPVVDFSTAENLAQMQCIRAYIAQQPDEMSVE
KADIILVHKDSGDNWIEGIRLSDQHFGWVPNSHLQVISNDKVKKRNL
Download sequence
Identical sequences M4AB26
ENSXMAP00000011670 ENSXMAP00000011670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]