SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012354 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012354
Domain Number 1 Region: 1141-1457
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.86e-90
Family p120GAP domain-like 0.0000000000396
Further Details:      
 
Domain Number 2 Region: 529-671,700-772,820-987,1030-1125,1179-1245,1284-1303
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000658
Family MIF4G domain-like 0.042
Further Details:      
 
Domain Number 3 Region: 1258-1400,1755-1796,1826-2061,2110-2292
Classification Level Classification E-value
Superfamily ARM repeat 0.00000269
Family PBS lyase HEAT-like repeat 0.077
Further Details:      
 
Domain Number 4 Region: 1492-1631
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000955
Family CRAL/TRIO domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012354   Gene: ENSXMAG00000012244   Transcript: ENSXMAT00000012370
Sequence length 2753
Comment pep:novel scaffold:Xipmac4.4.2:JH556852.1:442534:523818:1 gene:ENSXMAG00000012244 transcript:ENSXMAT00000012370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHKPVEWVQAVITRFDEQLPIKVGHQNTHSKVSTDHNKECLINISKYKFSLVISGLTT
ILKNVNNMRIFGEASEKNLYLSQLIILDTLEKCLAGQSKDCLRLDETMLVKQLLPEICHF
IHTYREAHQHAAELRASASAVLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELM
QYINVDCCKLKRLLQETVLKFRALKKAAQLAVINSLEKAFWNWVENYPDEFTMLYQRPQT
DMAEAAEKLFDLVDSFAESAKRKAAVWPLLIILLILCPEITHTISKDTVEESKANKKLFL
DNLRKALAGQGGGKQLMESAAIACVKLCKASTYINWEDHSTIFLLVQSIVMDLKTLLFNP
TKPFWRGTSSQNADVELMVDCFVSCFRINPHNNQHFKVCLASSSPSTFHFVLVNSLHRII
TNSHLDWWPKIDAVYHYSGELRFMFSDTLNRVVQSTGTHAPLRMTPSLTFIGKKTTSLKF
KEKATEQDTRSYKCLLLALVKLIHADPKLMLHNPVKQASEIQSSTAELITGLVQLVPLNT
TTQLSQEAMEALLVLHQPETIELWNPDAPIETFWDISSQVLFLICRKLISQQMVNRTEVL
KWLREILICRNKFLLKNKECATMGGGIPICRQAQTKLEVCLYLFLWSPDTEAVLVAMSCF
RHLCEEADIRSAADEVPVQTILPNYATFSELASVSTMIGTGRSTLQKRVMALLRRIEHPT
PGNIEAWEDTYAKWDQSTKQILNFPKNKADDGQQEWINMTGFLCALGGVCLQQRNTPGLA
TYSPPMGPLSDRKPSMISVGPGDMTNSAPSSCPSSTSIETPVSRFLDRLLSLLVCGHDRV
GLHVRTNVKDLLGLELSPALYPMLFNKLKNSIGKFSDAQGQVPITDANTQFVEQTIAIMK
NLLDNHTEGSSEHLGQASIETMMLNLVRYVRGLTNVVHAIQVKTKLCQLVEVMMERRDDL
SFCQEMKFRNKMVEYLTDWVMGTSNQAADDDIKCLTRDLDQASMEAVVSLLAGLPLQPEE
GDGVELMEAKSQLFLKYFTLFMNLLNDCSEVEDEGQTVGGRKRGMSRRLASLRHCTILAM
SNLLNANVDSGLMHSIGLGYHKDLQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLV
ELVTMMGDQGELPIAMALANVVPGSQWDELARVLVTLFDSRHLLYQLLWNMFSKEVELAD
SMQTLFRGNSLASKIMTFCFKVYGAAYLQKLLEPLLRGVISTPEHISFEVDPTRLEHGEN
LEENQRNLLQITERFFQAIIGSSSDFPPQLRSVCHCLYQVVSQRFPQNSIGAVGSAMFLR
FINPAIVSPYEAGILDKKPLPRVERGLKLMSKILQSIANHVLFTKEEHMRPFNDFVKSNF
DSARRFFLDIASDSPPSDSVNHSLSFISDGNVLALHRLLWNNQERIGQYLSSNRDHKAVG
RRPFDKMATLLAYLGPPEHKPVADTHWSSLNLTSSKFEEFMTRHQVHEKEEFKALKTLNI
FYQAGTSKTGNPVFYYVARRFKTGQINGDLLIYHVLLTLKPYYAKPYEIVVDLTHVGPSN
RFKTDFLSKWFVVFPGFAYENVAAVYVYNCNTWVREYTKYHERLLTGLKGSKRLQFIDSP
AKLAEHIEQDQQKLPAATLTLEEDLKVFHNALKLAHKDTKVSIKVGSTAVQVTSAERTRV
LGQPVFLNDVYYASEIEEICLVDESQFTLTMANQGTPLTFMHQECDAIVQSIIHIRTRWE
LSQPDSIPQHTKIRPKDVPGTLLNIALLNLGSSDPSLRSAAYNLLCALTCTFNLKIEGQL
LETSGLCIPANNTLFIVSISKTLAANEPHLTLEFLEECISGFSKSSIELKHLCLEYMTPW
LLNLVRFCKHNDDAKRQRVTAILDKLITMTINEKQMYPSIQAKIWGSLGQITDLLDVVLD
SFIKTSATGGLGSIKAEVMADTAVALASGNVKLVSNKVIGRMCKIIDKTCLSPTPTLEQH
LMWDDIAILARYMLMLSFNNSLDVAAHLPYLFHVVTLLVATGPLSLRASTHGLVINIIHS
LCTCSQLSFSEETKQVLRLSLTEFSLPKFYLLFGISKVKSAAVIAFRSSYRDRSFSPGSY
ERETFALSSLETVTEALLEIMEACMRDIPTCKWLDQWTELAQKFAFQYNPSLQPRALVVF
GCISKRVTHGQIKQIIRILSKASPLLSIDRGLESCLKGPDNYNSQVLIEATVIALTKLQP
LLSKDSPMHKALFWVAVAVLQLDEVNLYSAGTALLEQNLHTLDTMRIFNDKSPEEVFMEI
RRPLEWHCKQMDHFVGLNFSANFNFALVGHLLKGYRHPSPTTVARTVRILHTLLALTSKH
LKCDKFEVNTQSVAYLAALLTVSEEVRSRCSLKHRKSLLISELSVDPVPMETYTSHITNP
KCRTVQEPQPWTSPQVSERYLSTHHYPTMGQISPRTRKSMSLDMGQPSQANTKKLLGTRK
SFDHLISDSKAPKRPEMEAGMTTPPKMRRVAENDYEIETQRIGNSHLRKVSVSESNVLLD
EEVLTDPKIQALLLTVLATQVKYTTDDFDQRILYEYLAEASVVFPKVFPVVYNLLDSKIN
TVLSMCQDINLLNPVHGIVQSVVYHEESPPQYQPSYLQSFGFNGLWRFAGPFSKQTQIPD
YAELIVKFLEALIDSYLPTADEERGEEQLRTPTSPYPPSSQSQLSITANLNLSNSMTSLA
TSQHSPGVDKENVQLSPSSALSSGGRIRHGSASQVQKQRSAGSFKRPSIKKIV
Download sequence
Identical sequences M4AD10
ENSXMAP00000012354 ENSXMAP00000012354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]