SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012365 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012365
Domain Number 1 Region: 199-340
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-38
Family Second domain of FERM 0.000000989
Further Details:      
 
Domain Number 3 Region: 494-581
Classification Level Classification E-value
Superfamily Moesin tail domain 6.28e-31
Family Moesin tail domain 0.0000304
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-26
Family First domain of FERM 0.0000067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012365   Gene: ENSXMAG00000012314   Transcript: ENSXMAT00000012381
Sequence length 581
Comment pep:novel scaffold:Xipmac4.4.2:JH556871.1:330524:344200:1 gene:ENSXMAG00000012314 transcript:ENSXMAT00000012381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYVTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDENYCPPE
TAVLLASYAVQAKYGDYNKDVHKAGYLTHDRLLPQRVLEQHKLTKEQWEDRIQTWHEEHK
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTQLWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHHKQMERAQLENEKKKRELAEKEKERIEREKEELMERLRQIEEQTMK
AQRELEEQTRRAMELEQERQKAREEAEKLERERQAAEEAKAELAKQAAXQQKTQEQLATE
LAEFTAKIALLEEAKRKKEDEATEWQHKALSAQEDLEKTKEELKTAVTPAPAHPGGDAEP
EHDEQDENHAEASAELSNEGVCQLDLRSEEARVTEAQKNERVKKQLQTLSSELADARDET
KKTQNDVLHAENVKQGRDKYKTLRQIRQGNTKQRIDEFESM
Download sequence
Identical sequences M4AD21
ENSXMAP00000012365 ENSXMAP00000012365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]