SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSXMAP00000012494 from Xiphophorus maculatus 69_4.4.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSXMAP00000012494
Domain Number 1 Region: 256-355
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.89e-30
Family Ras-binding domain, RBD 0.0043
Further Details:      
 
Domain Number 2 Region: 391-503
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSXMAP00000012494   Gene: ENSXMAG00000012467   Transcript: ENSXMAT00000012510
Sequence length 1248
Comment pep:novel scaffold:Xipmac4.4.2:JH556871.1:441001:479878:-1 gene:ENSXMAG00000012467 transcript:ENSXMAT00000012510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQVSDDELDHGAEEDSDKEDQDLDKMFGAWLGELDKLTQSLDDGRPQKALQKPPLRQET
NIANFSYRFSMYNINEALNQGDTVDLDALMADLCSIEQELSTISKPNSASRSQNKGQQRG
PGGRSASTKHPTVRGGSASSRSAASNISLDDITSQLEKASLSMDEAARQTSSSSSTSSSS
SQHRRTGSVGTACEQEAQSQRSSINSACASASSMDSLDVDKGMTGGEADEQGSPSSQGEE
QAAKIKAEKIRVALEKIKEAQVKKLVIRVHMSDESSKTMMVDERQSVRQVLDSLLDKSHC
GYSPDWSLVETITELQMERIFEDHENLVENLLNWTRDSHNKLMFIERIEKYALFKNPQNY
LLGRKETSEMADRNKEALLEECFCGGSVSVPEIEGILWLKEDGKKSWKKRYFLLRASGIY
YVPKGKAKASRDLVCFLQLDHVNVYYGQDYRSKYKAPTDYCLALKHPQIQKKSQYIKYLC
CDDVRTLHQWVNGIRIAKYGKQLYVNYQEAMKRTEAAYDWSSLSTSSIRSGSSSASIPGE
FIFQSQTPLIMQHEAASSHGRSQSVVSSIFSEAWKRGTQMEENSKQQQQQQQHPPQPSLM
QQPTVIQPHRPPSPPQMLPPPPPDPPPPPPPPLPPPPPPLPPLQMVSHHSPAPTMYKYST
ITRLQNQKTSHKLPATAKQVLPPPLTPPAQVIKPNVNHIAARTNVPPPPPPPPPPSMPTP
GSAMAVLRFGPFNPAAPPSFIPPPPALHASDMTFPPPPPLPPPVFPPPPGPPQAPPKTFT
PGFMPHTAPKPMSPVSPFPPAPTPTPPPPPPPPPPPPAPSHLKKQPSLQQGHTHPPPTLP
KQHSLTKTVSVSAGAAPTMSLVKQLASQFPGASSQVNHAEYPKAPLSPPAVKTKPKWQPG
GSQQLLSPEFPPPPAESNNSFPAPPPPPPPPPPPPAPSTGPTPPPPPLPSGNMGSPLRRS
PSGSSSFGGKKPPPAPQRNSSIKANSSASYEESRRNLLSKFAPQGNSTPSSPCPISSFIG
SPSKDPSNGPPAPPKPGKLNLSNLPLALQAKVSQAKQAGGDFPSPPPECAYFPPPPPVSE
LFPPPPPPGNDVPRVAVVNPQPQAPPPPPPVSLVSNSIWAKNSLKKTPPPTLGRRSNTTP
EPPGISPPPPTSPKGSSGQPNFLADLSQTLKRKSVGRQGPGLPGKLDPVGTMDDMALPPP
PPELLLDQGKQSNGGNDGYMSGNISGYATLRRGPPPAPPKRGDATKLT
Download sequence
Identical sequences M4ADF0
ENSXMAP00000012494 ENSXMAP00000012494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]